SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000007787 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000007787
Domain Number 1 Region: 513-570
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.4e-26
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 2 Region: 401-458
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.46e-25
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 3 Region: 345-402
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.71e-24
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 4 Region: 289-346
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.54e-24
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 5 Region: 458-514
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.27e-22
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 6 Region: 587-639
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.03e-21
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 7 Region: 70-133
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 7.78e-21
Family SCAN domain 0.00029
Further Details:      
 
Domain Number 8 Region: 251-303
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.55e-20
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000007787   Gene: ENSPPYG00000006877   Transcript: ENSPPYT00000008114
Sequence length 645
Comment pep:known chromosome:PPYG2:15_random:9435649:9458648:1 gene:ENSPPYG00000006877 transcript:ENSPPYT00000008114 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMAAEIPRVTTPLSPLVQVPQEEDRQKEEVTTMILEDDSWVQEAVLQEDGPESEPFPQSA
GKGSPQEEVTRGPQGALGRLRELCRRWLRPEVHTKEQMLTMLPKEIQAWLQEHRPESSEE
AAALVEDLTQTLQDSGSQCVHQPFSVLTVCNVSSRTAWRVLELHLNYFEIQSENGENCNQ
DMFENESREIFSEMPEGESAQHSDGESDFERDAGIQRPQGHTPGKDHGEVLSQDREVGQL
IGLQGTYLGEKPYECPQCGKTFSRKSHLITHERTHTGEKYYKCDECGKSFSDGSNFSRHQ
TTHTGEKPYKCRDCGKSFSRSANLITHQRIHTGEKPFQCAECGKSFSRSPNLIAHQRTHT
GEKPYSCPECGKSFGNRSSLNTHQGIHTGEKPYECKECGESFSYNSNLIRHQRIHTGEKP
YKCTDCGQRFSQSSALITHRRTHTGEKPYQCSECGKNFSRSSNLATHRRTHMVEKPYKCG
VCGKSFSQSSSLIAHQGMHTGEKPYECLTCGESFSWSSNLLKHQRIHTGEKPYKCSECGK
CFSQRSQLVVHQRTHTGEKPYKCLMCGKSFSRGSILVMHQRAHLGDKPYRCPECGKGFSW
NSVLIIHQRIHTGEKPYKCPECGKGFSNSSNFITHQRTHMKEKLY
Download sequence
Identical sequences H2NPG5
9600.ENSPPYP00000007787 ENSPPYP00000007787 ENSPPYP00000007787

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]