SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000007809 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPPYP00000007809
Domain Number - Region: 19-102
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000102
Family delta-Endotoxin, C-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000007809   Gene: ENSPPYG00000006897   Transcript: ENSPPYT00000008136
Sequence length 540
Comment pep:known_by_projection chromosome:PPYG2:16:66730:123114:-1 gene:ENSPPYG00000006897 transcript:ENSPPYT00000008136 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRDNTSPISVILVSSGSRGNKLLFRYPFQRSQEHPASQTNKPRSRYAVNNTGDHADDQDG
DSRFSDVILATILATKSEMCGQKFELKIDNVRFVGHPTLLQHALGQANADPSVINCLHNL
SRRIATVLQHEERRCQYLTREAKLILALQDEVSAMADGNEGPQSPFHHILPKCKLARDLK
EAYDTSGVVRLHINSWLEVSFFQAHKIHYAASSLIPPEAIERSLKAIRPYHALLLLSDEK
SLLGELPIDCSPALVRVIKTTSAVKNLQQLAQDADLALLQVFQLAAHLVYWGKAIIIYPL
CENNVYMLSPNASVCLYSPLAEQFSHQFPSHDLPSVLAKFSLPVSLSEFRNPLAPAVQET
QLIQMVVWMLQRRLLIQLHTYVCLMASPSEEEPRPREDDVPFTARVGGRSLSTPNALSFG
SPTSSDDMTLTSPSMDNSSAELLPSGDSPLNQRMTENLLASLSEHERAAILSVPAAQNPE
DLRMFARLLHYFRGRHHLEEIMYNENTRRSQLLMLDKFRSVLVVTTHEDPVIAVFQALLP
Download sequence
Identical sequences H2NPI5
ENSPPYP00000007809 9600.ENSPPYP00000007809 ENSPPYP00000007809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]