SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000007810 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000007810
Domain Number 1 Region: 1-141
Classification Level Classification E-value
Superfamily Globin-like 5.96e-43
Family Globins 0.0000154
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000007810   Gene: ENSPPYG00000006898   Transcript: ENSPPYT00000008137
Sequence length 141
Comment pep:known_by_projection chromosome:PPYG2:16:152493:153258:1 gene:ENSPPYG00000006898 transcript:ENSPPYT00000008137 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSAQERAQIAQVWDLIAGHEAQFGAELLLRLFTVYPSTKVYFPHLSACQDATQLLSHGQ
RMLAAVGAAVQHMDNLRAALSPLADLHALVLRVDPANFPLLIQCFHVVLASHLQDEFTVQ
MQAAWDKFLTGVAVVLTEKYR
Download sequence
Identical sequences G3QY87 H2NPI6
ENSPPYP00000007810 ENSPPYP00000007810 ENSGGOP00000007817 ENSGGOP00000007817 XP_003778571.1.23681 XP_004056908.1.27298 9600.ENSPPYP00000007810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]