SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000007811 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000007811
Domain Number 1 Region: 1-142
Classification Level Classification E-value
Superfamily Globin-like 2.5e-49
Family Globins 0.000000193
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000007811   Gene: ENSPPYG00000006899   Transcript: ENSPPYT00000008138
Sequence length 142
Comment pep:novel chromosome:PPYG2:16:166789:167660:1 gene:ENSPPYG00000006899 transcript:ENSPPYT00000008138 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLSPADKTNVKTAWGKVGAHAGDYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHG
KKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTP
AVHASLDKFLASVSTVLTSKYR
Download sequence
Identical sequences H2NPI7
XP_009248506.1.23681 ENSPPYP00000007811 9600.ENSPPYP00000007811 ENSPPYP00000007811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]