SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000007812 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000007812
Domain Number 1 Region: 3-139
Classification Level Classification E-value
Superfamily Globin-like 6.87e-40
Family Globins 0.00000803
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000007812   Gene: ENSPPYG00000006900   Transcript: ENSPPYT00000008139
Sequence length 139
Comment pep:known_by_projection chromosome:PPYG2:16:170735:172577:1 gene:ENSPPYG00000006900 transcript:ENSPPYT00000008139 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALSAEDRALVRALWKKLGSNVGVYTTEALERTFLAFPATKTYFSHLDLSPGSSQVRAHG
QKVADALSLAVERLDDLPHALSALSHLHACQLRVDPASFQHCLLVTLARHYPGDFSPPLQ
ASLDKFLSHVISALASEYR
Download sequence
Identical sequences H2NPI8
ENSPPYP00000007812 ENSPPYP00000007812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]