SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000007855 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000007855
Domain Number 1 Region: 86-174
Classification Level Classification E-value
Superfamily HMG-box 9.03e-29
Family HMG-box 0.0000461
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000007855   Gene: ENSPPYG00000006937   Transcript: ENSPPYT00000008182
Sequence length 446
Comment pep:known_by_projection chromosome:PPYG2:16:995220:1000424:1 gene:ENSPPYG00000006937 transcript:ENSPPYT00000008182 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLDMSEARSQPPCSPSGTASSMSHVEDSDSDAPPSPAGSEGLGRAGGAVGGARGDPAEAA
DERFPACIRDAVSQVLKGYDWSLVPMPVRGGGGGALKAKPHVKRPMNAFMVWAQAARRKL
ADQYPHLHNAELSKTLGKLWRLLSESEKRPFVEEAERLRVQHKKDHPDYKYQPRRRKSAK
AGHSDSDSGAELGPHPGGGAVYKAEAGLGDAHHHGDHTGQTHGPPTPPTTPKTELQQAGA
KPELKLEGRRPADSGRQNIDFSNVDISELSSEVMGTMDAFDVHEFDQYLPLGGPAPPEPG
QAYGGTYFHAGASPVWAHKSAPSASASPTETGPPRPHIKTEQPSPGHYGDQPRGSPDYGS
CSGQASAAPTAPAGPFPGAQGDYSDLQASSYYSAYPGYAPGLYQYPCFHSPRRPYASPLL
NGLALPPAHSPTSHWDQPVYTTLTRP
Download sequence
Identical sequences H2NPN0
XP_002825986.2.23681 9600.ENSPPYP00000007855 ENSPPYP00000007855 ENSPPYP00000007855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]