SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000007880 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000007880
Domain Number 1 Region: 660-864
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0000000000128
Family WD40-repeat 0.015
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000007880
Domain Number - Region: 213-266
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.000915
Family RILP dimerisation region 0.0081
Further Details:      
 
Domain Number - Region: 107-176
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0128
Family Myosin rod fragments 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000007880   Gene: ENSPPYG00000006960   Transcript: ENSPPYT00000008207
Sequence length 1027
Comment pep:known_by_projection chromosome:PPYG2:16:1770765:1820923:1 gene:ENSPPYG00000006960 transcript:ENSPPYT00000008207 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KFIEFEDALEQEKKELQIQVEHYEFQTRQLELKAKNYADQISRLEERESEMKKEYNALHQ
RHTEMIQTYVEHIERSKMQQVGGNSQTESSLPGREFSVRDDFFGMGKEVGNLLLENSQLL
ETKNALNVVKNDLIAKVDQLSGEQEVLRGELEAAKQAKVKLENRIKELEEELKRVKSEAI
IARREPKEEAEDVSSYLCTESDKIPMAQRRRFTRVEMARVLMERNQYKERLMELQEAVRW
TEMIRASREHPSVQEKKKSTIWQFFSRLFSSSSSPPPAKRPYPSVNIHYKSPTTAGFSQR
RNHAMCPISAGSRPLEFFPDDDCTSSARREQKREQYRQVREHVRNDDGRLQACGWSLPAK
YKQLSPNGGQEDTRMKNVPVPVYCRPLVEKDPTMKLWCAAGVNLSGWRPNEDDAGNGVKP
APGRDPLTCDREGDGEPKSAHTSPEKKKAKELPEMDATSSRVWILTSTLTTSKVVIIDAN
QPGTVVDQFTVCNAHVLCISSIPAASDSDYPPGEMFLDSDVNPEDPGADGVLAGITLVGC
ATRCNVPRSNCSSRGDTPVLDKGQGEVATIANGKVNPSQSTEEATEATEVPDPGPSEPET
ATLRPGPLTEHVFTDPAPTPSSGPQPGSENGPEPDSSSTQPEPEPSEDPTGAGSSAAPTM
WLGAQNGWLYVHSAVANWKKCLHSIKLKDSVLSLVHVKGRVLVALADGTLAIFHRGEDGQ
WDLSNYHLMDLGHPHHSIRFFMRGVVYDRVWCGYKNKVHVIQPKTMQIEKSFDAHPRRES
QVRQLAWIGDGVWVSIRLDSTLRLYHAHTHQHLQDVDIEPYVSKMLGTGKLGFSFVRITA
LLVAGSRLWVGTGNGVVISIPLTETVVLHRGQLLGLRANKTSPTSGEGARPGGIIHVYGD
DSSDRAASSFIPYCSMAQAQLCFHGHRDAVKFFVSVPGNVLATLNGSVLDSPAEGPGPAA
PASEVEGQKLRNVLVLSGGEGYIDFRIGDGEDDETEEGAGDMSQVKPVLSKAERSHIIVW
QVSYTPE
Download sequence
Identical sequences H2NPQ4
ENSPPYP00000007880 9600.ENSPPYP00000007880 ENSPPYP00000007880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]