SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000007955 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000007955
Domain Number 1 Region: 429-485
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.01e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 2 Region: 345-401
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.34e-22
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 3 Region: 470-522
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.87e-18
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 4 Region: 306-358
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.92e-18
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 5 Region: 118-168
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000000968
Family KRAB domain (Kruppel-associated box) 0.0033
Further Details:      
 
Domain Number 6 Region: 391-423
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000406
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000007955   Gene: ENSPPYG00000007034   Transcript: ENSPPYT00000008286
Sequence length 554
Comment pep:known_by_projection chromosome:PPYG2:16:3264254:3271950:1 gene:ENSPPYG00000007034 transcript:ENSPPYT00000008286 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSADGGGIQDTQDKETPLEVPDRGHPHQEMPSKLGEAVPSGDIQESLHIKMEPEEPHPEG
ASQEDGAQGAWGWAPLSHGSKEKALFLPGGALPSPRIPVLSREGRTRDRQMAAALLTAWS
QMPVTFEDVALYLSREEWGRLDHTQQNFYRDVLQKKNGLSLGFPFSRPFWAPQAHGKGEA
SGSSRQTGDEKEWRGACTGAVEVGQRVPTSSVAALGDVKPFRPRAGSVQGGVLQCAQEAA
CGRSSGPAKDSGQPADPDRTLDAAPPDPSPTEPQECRVPEKPSEEEKGAPESGEEGLAPD
SEAGRKSYRCEQCGKGFSWHSHLVTHRRTHTGEKPYACTDCGKRFGRSSHLIQHQIIHTG
EKPYTCPACRKSFSHHSTLIQHQRIHTGEKPYVCDRCAKRFTRRSDLVTHQGTHTGAKPH
KCPICGKCFTQSSALVTHQRTHTGVKPYPCPECGKCFSQRSNLIAHNRTHTGEKPYHCLD
CGKSFSHSSHLTAHQRTHRGVRPYACPLCGKSFSRRSNLHRHEKIHTTGPKALAMLMLGA
AAAGALATPPPAPT
Download sequence
Identical sequences H2NPX8
ENSPPYP00000007955 XP_009248662.1.23681 XP_009248663.1.23681 XP_009248664.1.23681 XP_009248665.1.23681 XP_009248666.1.23681 XP_009248667.1.23681 XP_009248668.1.23681 ENSPPYP00000007955 9600.ENSPPYP00000007955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]