SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000007965 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000007965
Domain Number 1 Region: 30-120
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.93e-40
Family SCAN domain 0.0000449
Further Details:      
 
Domain Number 2 Region: 529-586
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6e-25
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 3 Region: 585-642
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.33e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 4 Region: 627-679
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.24e-17
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 5 Region: 206-248
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000445
Family KRAB domain (Kruppel-associated box) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000007965   Gene: ENSPPYG00000007043   Transcript: ENSPPYT00000008296
Sequence length 697
Comment pep:known_by_projection chromosome:PPYG2:16:3498624:3515861:-1 gene:ENSPPYG00000007043 transcript:ENSPPYT00000008296 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMAAVKSTEAHPSSNKDPTQGQKSALQGNSPDSEASRQRFRQFCYQEVTGPHEAFSKLWE
LCCQWLRPKTHSKEEILELLVLEQFLTILPEEIQTWVREQHPENGEEAVALVEDVQRAPG
QQVLDSEKDLKVLMEEMAPLGATRESLRSQWKQEVQPEEPTFKGSQSSHQRPGEQSEAWL
APQAPRNLPQNTGLHDQETGAVVWTAGSQGPATCDNRAVSLCQQEWMCPGPAQRALYRGA
TQRKDRHVSRATGVPWGYEETKTLLAILSSSQFYGKLQTCQQNSQIYRAMAEGLWQQGFL
RTPEQCRTKFKSLQLSYCKVRRGRVPEPCIFYEEMNALSSFWDSAPPMASDAVPGQEGSD
IEAGELNHQNGEPTEVEDGTVDGAERDEKDFRNPVQKVRKLDLPVLFPNRLGFEIKNEIK
KENLKWDDSEEVEINKALQRKSRGVYWHSELQKGLESEPTSKRQCRNSPGESEEKTPSQE
KMSHQSFCARDKAYTHILCGKNCSQSVHSPHKPALELEKVSQCPECGKTFSRSSYLVRHQ
RIHTGEKPHKCSECGKGFSERSNLTAHLRTHTGERPYQCGQCGKSFNQSSSLIVHQRTHT
GEKPYQCIVCGKRFNNSSQFSAHRRIHTGESPYKCVECGKSFNNSSHFSAHRKTHTGEKP
YSCSHCERGFTKNSALTRHQTVHMKAVLSSQEGRDVL
Download sequence
Identical sequences H2NPY8
ENSPPYP00000007965 9600.ENSPPYP00000007965 ENSPPYP00000007965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]