SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000007967 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000007967
Domain Number 1 Region: 40-131
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.65e-37
Family SCAN domain 0.0000025
Further Details:      
 
Domain Number 2 Region: 348-400
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.85e-20
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 3 Region: 312-363
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.94e-17
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000007967   Gene: ENSPPYG00000007045   Transcript: ENSPPYT00000008298
Sequence length 407
Comment pep:known_by_projection chromosome:PPYG2:16:3516058:3524232:1 gene:ENSPPYG00000007045 transcript:ENSPPYT00000008298 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAKMEITLSSNTEASSKQERHIIAKLEEKRGPTLQKNCPDPELCRQSFRRFCYQEVSGP
QEALSQLRQLCRQWLQPELHTKEQILELLVMEQFLTILPPEIQARVRHRCPMSSKEIVTL
VEDFHRASKKPKQWVAVCMQGQKVLLEKTGSQLGEQELPDFQPQTPRRDLRESSPAEPSQ
AGAYDRLSPHHWEKSPLLQEPTPKLAGTEAPRMRSDNKENPQQEGAKGAKPCAVSAGRSK
GNGLQNPEPRGANMSEPRLSRRQVSPPNAQKPFAHYQRHCRVEYISSPLKSHPLRELKKS
KGGKRSLSNRLQHLGHQPTRSAKKPYKCDDCGKSFTWNSELKRHKRVHTGERPYTCGECG
NCFGRQSTLKLHQRIHTGEKPYQCGQCGKSFRQSSNLHQHHRLHHGD
Download sequence
Identical sequences H2NPZ0
XP_009248682.1.23681 XP_009248683.1.23681 9600.ENSPPYP00000007967 ENSPPYP00000007967 ENSPPYP00000007967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]