SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000007979 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000007979
Domain Number 1 Region: 49-121
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.03e-17
Family HLH, helix-loop-helix DNA-binding domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000007979   Gene: ENSPPYG00000007054   Transcript: ENSPPYT00000008310
Sequence length 338
Comment pep:known_by_projection chromosome:PPYG2:16:4382639:4398458:-1 gene:ENSPPYG00000007054 transcript:ENSPPYT00000008310 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEYFMVPTQKVPSLQHFRKTEKEVIGGLCSLANIPLTPETQRDQERRIRREIANSNERRR
MQSINAGFQSLKTLIPHTDGEKLSKAAILQQTAEYIFSLEQEKTRLLQQNTQLKRFIQEL
SGSSPKRRRAEDKDEGIGSPDIWEDEKAEDLRREMIELRQQLDKERSVRMMLEEQVRSLE
AHMYPEKLQVIAQQVQLQQQQEQVRLLHQEKLEREQQHLRTQLLPPPAPTHHPTVIVPAP
PPPPSHHINVVTMGPSSVINSVSTSRQNLDTIVQAIQHIEGTQEKQELEEEQRRAVIVKP
VRSCPEAPTSDTASDSEASDSDAMDQSREEPSGDGELP
Download sequence
Identical sequences H2NQ02
9600.ENSPPYP00000007979 ENSPPYP00000007979 ENSPPYP00000007979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]