SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000008052 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000008052
Domain Number 1 Region: 1-136,268-405
Classification Level Classification E-value
Superfamily Ribonuclease H-like 4.97e-63
Family CAF1-like ribonuclease 0.014
Further Details:      
 
Domain Number 2 Region: 172-257
Classification Level Classification E-value
Superfamily R3H domain 8.44e-34
Family R3H domain 0.0000149
Further Details:      
 
Domain Number 3 Region: 439-522
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000000846
Family Canonical RBD 0.00000774
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000008052   Gene: ENSPPYG00000007123   Transcript: ENSPPYT00000008387
Sequence length 640
Comment pep:known chromosome:PPYG2:16:14910960:15105135:-1 gene:ENSPPYG00000007123 transcript:ENSPPYT00000008387 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEIIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVSALTNGFDTPEERYQKLMKG
NHSMDFLLFQFGLCTFKYDYTDSKYITKSFNFYVFPKPFNRSSPDVKFVCQSSSIDFLAS
QGFDFNKVFRNGIPYLNQEEERQLREQYDEKRSQANGAGALSYVSPNTSKCPVTIPEDQK
KFIDQVVEKIEDLLQSEENKNLDLEPCTGFQRKLIYQTLSWKYPKGIHVETLETEKKERY
IVISKVDEEERKRREQQKHAKEQEELNDAVGFSRVIHAIANSGKLVIGHNMLLDVMHTVH
QFYCPLPADLSEFKEMTTCVFPRLLDTKLMASTQPFKDIINNTSLAELEKRLKETPFSPP
KVESAEGFPSYDTASEQLHEAGYDAYITGLCFISMANYLGSFLSPPKIHVSARSKLIEPF
FNKLFLMRVMDIPYLNLEPDLQPKRDHVLHVTFPKEWKTSDLYQLFSAFGNIQISWIDDT
SAFVSLSQPEQVKIAVNTSKYAESYRIQTYAEYMGRKQEEKQIKRKWTEDSWKEADSKRL
NPQCIPYALQNHYYRNNSFTAPSTVGKRNLSPSQEEAGLEDGVSGEISDTELEQTDSCAE
PLSEGRKKAKKLKRMKKELSPAGSISKNSPATLFEVPDTW
Download sequence
Identical sequences H2NQ72
9600.ENSPPYP00000008052 ENSPPYP00000008052 ENSPPYP00000008052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]