SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000008062 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPPYP00000008062
Domain Number - Region: 107-178
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00238
Family Myosin rod fragments 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000008062   Gene: ENSPPYG00000007132   Transcript: ENSPPYT00000008397
Sequence length 349
Comment pep:known_by_projection chromosome:PPYG2:16:15727695:15793309:1 gene:ENSPPYG00000007132 transcript:ENSPPYT00000008397 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HHATRRVISSPVFIMEDSGKTFSSEEEEANYWKDLAMTYKQRAENTQEELREFQEGSREY
EAELETQLQQIETRNRDLLSENNRLRMELETIKEKFEVQHSEGYRQISALEDDLAQTKAI
KDQLQKYIRELEQANDDLERAKRATIMSLEDFEQRLNQAIERNAFLESELDEKENLLESV
QRLKDEARDLRQELAVQQKQEKPRTPMPSSVEAERTDTAVQATGSVPSTPIAHRGPSSSL
NTPGSFRRGLDDSTGGTPLTPAARISALNIVGDLLRKVGALESKLASCRNLVYDQSPNRT
GGPASGRSSKNRDGGERRPSSTSVPLGDKGLDTSCRWLSKSTTRSSSSC
Download sequence
Identical sequences H2NQ82
9600.ENSPPYP00000008062 ENSPPYP00000008062 ENSPPYP00000008062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]