SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000008063 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000008063
Domain Number 1 Region: 36-775
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.68e-260
Family Motor proteins 1.08e-16
Further Details:      
 
Domain Number 2 Region: 1066-1177
Classification Level Classification E-value
Superfamily Myosin rod fragments 7.72e-20
Family Myosin rod fragments 0.0025
Further Details:      
 
Domain Number 3 Region: 870-972
Classification Level Classification E-value
Superfamily Myosin rod fragments 1.31e-18
Family Myosin rod fragments 0.0013
Further Details:      
 
Domain Number 4 Region: 771-877
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000000000000126
Family Myosin rod fragments 0.00023
Further Details:      
 
Domain Number 5 Region: 1343-1456
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000000000706
Family Myosin rod fragments 0.0014
Further Details:      
 
Domain Number 6 Region: 1179-1279
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000000118
Family Myosin rod fragments 0.0059
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000008063
Domain Number - Region: 1548-1655
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000667
Family Myosin rod fragments 0.0045
Further Details:      
 
Domain Number - Region: 1458-1572
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0204
Family Myosin rod fragments 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000008063   Gene: ENSPPYG00000007133   Transcript: ENSPPYT00000008398
Sequence length 1794
Comment pep:known_by_projection chromosome:PPYG2:16:15770294:15924014:-1 gene:ENSPPYG00000007133 transcript:ENSPPYT00000008398 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQKGQLSDDEKFLFVDKNFINSPVAQADWAAKRLVWVPSEKQGFEAASIKEEKGDEVVV
ELVENGKKVTVGKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLRERYFSGLIYTYSGL
FCVVVNPYKHLPIYSEKIVDMYKGKKRHEMPPHIYAIADTAYRSMLQDREDQSILCGELE
KQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDVTGYIVGANIETYLLEKSRAIRQA
RDERTFHIFYYMIAGAKEKMRSDLLLEGFNNYTFLSNGFVPIPAAQDDEMFQETVEAMAI
MGFSEEEQLSILKVVSSVLQLGNIVFKKERNTDQASMPDNTAAQKVCHLMGINVTDFTRS
ILTPRIKVGRDVVQKAQTKEQADFAVEALAKATYERLFRWILTRVNKALDKTHRQGASFL
GILDIAGFEIFEVNSFEQLCINYTNEKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDL
QPCIELIERPNNPPGVLALLDEECWFPKATDKSFVEKLCTEQGSHPKFQKPKQLKDKTEF
SIIHYAGKVDYNASAWLTKNMDPLNDNVTSLLNASSDKFVADLWKDVDRIVGLDQMAKMT
ESSLPSASKTKKGMFRTVGQLYKEQLGKLMTTLRNTTPNFVCRIIPNHEKRSGKLDAFLV
LEQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYEILAANAIPKGFMDGKQACILMIKALE
LDPNLYRIGQSKIFFRTGVLAHLEEERDLKITDVIMAFQAMCRGYLARVKPLLQVTRQEE
EMQAKEDELQKTKERQQKAESELKELEQKHLQLTKEKNLLQEQLQAETEMYAEAEEMRVR
LAAKKQELEILHEMEARLEEEEDGQQLQAERKKMAQQMLILVMDDQNNNLSKERKLLEER
ISDLTTNFAEEEEKAKNLTKLKNKHESMISELEVRLKKEEKSRQELEKLKRKLEGDASDF
HEQIADLQAQIAELKMQLAKKEEELQAALARAKREQEVTVLKKALDEETRSHEAQVQEMR
QKHAQAVEELTEQLEQFKRAKANLDKNKQTLEKENADLAGELRVLGQAKQEVEHKKKKLE
AQVQELQSKCSDGERARAELNDKVHKLQNEVESVTGMLNEAEGKAIKLAKDVASLSSQLQ
DTQELLQEETRQKLNVSTKLRQLEEERNSLQDQLDEEMEAKQNLERHISTLNIQLSDSKK
KLQDFASTVEALEEGKKRFQKEIENLTQQYEEKAAAYDKLEKTKNRLQQELDDLVVDLDN
QRQLVSNLEKKQRKFDQLLAEEKNISSKYADERDRAEAEAREKETKALSLARALEEALEA
KEELERTNKMLKAEMEDLVSSKDDVGKNVHELEKSKRALETQMEEMKTQLEELEDELQAT
EDAKLRLEVNMQALKGQFERDLQARDEQSEEKRRQLQRQLHEYETELEDERKQRALAAAA
KKKLEGDLKDLELQADSAIKGREEAIKQLRKLQAQMKDFQRELEDARASRDEIFATAKEN
EKKAKSLEADLMQLQEDLAAAERARKQADLEKEELAEELASSLSGRNALQDEKRRLEARI
AQLEEELEDEQGNMEAMSDRVRKATQQAEQLSNELATERSTAQKNESARQQLERQNKELR
SKLQEMEGAVKSKFKSTIAALEAKIAQLEEQVEQEAREKQVATKSLKQKDKKLKEILLQV
EDERKMAEQYKEQAEKGNARVKQLKRQLEEAEEESQRINANRRKLQRELDEATESNEAMG
REVNALKSKLRRGNETSFVPSRRSGGRRVIENADGSEEETDTRDADFNGTKASE
Download sequence
Identical sequences H2NQ83
ENSPPYP00000008063 ENSPPYP00000008063 9600.ENSPPYP00000008063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]