SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000008068 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000008068
Domain Number 1 Region: 244-318
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.0000000000824
Family Rhamnogalacturonase B, RhgB, middle domain 0.022
Further Details:      
 
Domain Number 2 Region: 883-972
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0000000589
Family Carboxypeptidase regulatory domain 0.027
Further Details:      
 
Domain Number 3 Region: 52-115
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.000000318
Family Cna protein B-type domain 0.0097
Further Details:      
 
Domain Number 4 Region: 802-873
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.00000922
Family Rhamnogalacturonase B, RhgB, middle domain 0.039
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000008068
Domain Number - Region: 729-787
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.00247
Family Cna protein B-type domain 0.0097
Further Details:      
 
Domain Number - Region: 130-214
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.00294
Family Rhamnogalacturonase B, RhgB, middle domain 0.02
Further Details:      
 
Domain Number - Region: 357-409
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00902
Family Carboxypeptidase regulatory domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000008068   Gene: ENSPPYG00000007137   Transcript: ENSPPYT00000008403
Sequence length 1067
Comment pep:known chromosome:PPYG2:16:16329088:16381767:1 gene:ENSPPYG00000007137 transcript:ENSPPYT00000008403 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GDFILKIEPPLGWSFEPTTVELHVDGSLILLKHIHDLYHLFNGILDPKKVLSKGQPLGPA
GVQVSLRNTGTEAKIQSTVTQPGGKFAFFKVLPGDYEILATHPTWALKEASTTVRVTNSN
ANAASPLIVAGYNVSGSVRSDGEPMKGVKFLLFSSLVTKEDVLGCNVSPVPGFQPQDESL
VYLCYTVSREDGSFSFYSLPSGGYTVIPFYRGERITFDVAPSRLDFTVEHDSLKIEPVFH
VMGFSVTGRVLNGPEGDGVPEAVVTLNNQIKVKTKADGSFRLENITTGTYTIHAQKEHLY
FETVTIKIAPNTPQLADIIATGFSVCGQISIIRFPDAVKQMNKYKVVLSSQDKDKSLVTV
ETDAHGSFCFKAKPGTYKAQVMVPEAETRAGLTLKPQTFPLTVTDRPVMDVAFVQFLASV
SGKVSCLDTCGDLLVTLQSLSRQGEKRSLQLSGKVNSLTFTFDNVLPGKYKISIMHEDWC
WKNKSLEVEVLEDDVSAVEFRQTGYMLRCSLSHAITLEFYQDGNGRENVGIYNLSKGVNR
FCLSKPGVYKVTPRSCHRFEQAFYTYDTSSPSILTLTAIRHHVLGTITTDKMMDVTVTIK
SSIDSEPALVLGPLKSVQELRREQQLAEIEARRQEREKKGKEEGEERMXXXXRMTKPPQE
MVDELQGPTYDFSYWARSGEKITVTPSSKELLFYPPSMEAVVSGESCPGKLIEIHGKAGL
FLEGQIHPELEGVEIVISEKGASSPLITVFTDDKGAYSVGPLHSDLEYTVTSQKEGYVLT
AVEGTIGDFKAYALAGVSFEIKAEDDQPLPGVLLSLSGGLFRSNLLTQDNGILTFSNLSP
GQYYFKPMMKEFRFEPSSQMIEVQEGQNLKITITGYRTAYSCYGTVSSLNGEPEQGVAVE
AVGQNDCSIYGEDTVTDEDGKFRLRGLLPGCVYHVQLKAEGNDHIERALPHHRVIEVGNN
DIDDVNIIVFRQINQFDLSGNVITSSEFLPTLWVKLYKSENLDNPIQTVSLGQSLFFHFP
PLLRDGENYVVLLDSTLPRSQYDYILPQVSFTAVGYHKHITLIFNPT
Download sequence
Identical sequences H2NQ88
ENSPPYP00000008068 9600.ENSPPYP00000008068 ENSPPYP00000008068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]