SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000008173 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000008173
Domain Number 1 Region: 23-432
Classification Level Classification E-value
Superfamily MFS general substrate transporter 3.27e-20
Family Glycerol-3-phosphate transporter 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000008173   Gene: ENSPPYG00000007229   Transcript: ENSPPYT00000008510
Sequence length 438
Comment pep:novel chromosome:PPYG2:16:27895677:27915844:-1 gene:ENSPPYG00000007229 transcript:ENSPPYT00000008510 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGCAGSRRRFSDSEGEETVPEPRLPLLDHQGAHWKNAVGFWLLGLCNNFSYVVMLSAAH
DILSHERTSGNQSHVDPGPTPIPHNSSSRFDCNSVSTAAVLLADILPTLIIKLLAPLGLH
LLPYSPRVLVSGICAAGSFVLVAFSHSVGTSLCGVVFASISSGLGEVTFLSLTAFYPRAV
ISWWSSGTGGAGLLGALSYLGLTQAGLSPQQTLLSMLGIPALLLASYFLLLTSPEAQDPG
GEEEAESAARQPLVGTEAPESKPGSSSSLSLRERWTVFKGLLWYIVPLVVVYFAEYFINQ
GLFELLFFRNTSLSHAQQYRWYQMLYQAGVFASRSSLRCCRIRFTWALALLQCLNLAFLL
ADVWFGFLPSIYLVFLIILYEGLLGGAAYVNTFHNIALETSDEHREFAMAATCISDTLGI
SLSGLLALPLHDFLCQLS
Download sequence
Identical sequences H2NQI8
XP_002826327.1.23681 ENSPPYP00000008173 9600.ENSPPYP00000008173 ENSPPYP00000008173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]