SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000008218 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000008218
Domain Number 1 Region: 313-369
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.85e-21
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 2 Region: 191-243
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.66e-19
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 3 Region: 450-502
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.3e-19
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 4 Region: 121-170
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.29e-18
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 5 Region: 543-594
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.07e-17
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 6 Region: 274-326
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.91e-17
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000008218   Gene: ENSPPYG00000007271   Transcript: ENSPPYT00000008556
Sequence length 619
Comment pep:known_by_projection chromosome:PPYG2:16:28909706:28914083:1 gene:ENSPPYG00000007271 transcript:ENSPPYT00000008556 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERAVEPWGPDLHGPEEREPLRGARTGLGSENVISQPHVFEHTPQEDDLGFKEEEELAPD
HEVGNASLKPEGIQNWDDLWVQREGLGKPQPRDRGPRLLGEPRWGQASSDRAAVCGECGK
SFRQMSDLVKHQRTHTGEKPYKCGVCGKGFGDSSARIKHQRTHSGEKPYRARPPAQGPPK
IPRSRIPAGERPTICGECGKSFRQSSDLVKHQRTHTGEKPYKCGICGKGFGDSSARIKHQ
RTHRGEQPPRPVVPRRQPSRAATAATQGPKAQDKPYICTDCGKRFVLSCSLLSHQRSHLG
PKPFGCDVCGKEFARGSDLVKHLRVHTGEKPYLCPECGKGFADSSARVKHLRTHSGERPH
ACPECDRTFSLSSTLLRHRLTHMEPQDFSFPGYPLPALIPSPPPPPLGTSPPLTPRSPSH
SGEPFGLPGLEPEPGGPQAGEPPPPLAGDKPHKCPECGKGFRRSSDLVKHHRVHTGEKPY
LCPECGKGFADSSARVKHLRTHRGERARPPPPSTLLRPHNPPGPVPMAPRPRVRAQPSGP
SQPHVCGFCGKEFPRSSDLVKHRRTHTGEKPYKCAECGKGFGDSSARIKHQRGHLVLRPF
GIGDGRARPLKQEAPTGLE
Download sequence
Identical sequences H2NQN3
9600.ENSPPYP00000008218 ENSPPYP00000008218 ENSPPYP00000008218 XP_009248911.1.23681 XP_009248912.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]