SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000008221 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000008221
Domain Number 1 Region: 26-146,328-614
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 4.88e-55
Family Integrin alpha N-terminal domain 0.0000805
Further Details:      
 
Domain Number 2 Region: 155-333
Classification Level Classification E-value
Superfamily vWA-like 1.91e-41
Family Integrin A (or I) domain 0.0000000158
Further Details:      
 
Domain Number 3 Region: 615-774
Classification Level Classification E-value
Superfamily Integrin domains 5.23e-22
Family Integrin domains 0.0064
Further Details:      
 
Domain Number 4 Region: 775-901
Classification Level Classification E-value
Superfamily Integrin domains 0.000000000000141
Family Integrin domains 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000008221   Gene: ENSPPYG00000007275   Transcript: ENSPPYT00000008560
Sequence length 1131
Comment pep:known_by_projection chromosome:PPYG2:16:28988005:29036092:1 gene:ENSPPYG00000007275 transcript:ENSPPYT00000008560 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKDSCITVMAMALLSGFFFFAPASSYNLDVRGARSFSPPRAGRHFGYRVLQVGKVGVIVG
APGEGNSTGSLYQCQSGTGHCLPLSLRDSNYTSKYLGMTLATGPTDGSILACDPGLSRTC
DQNTYLSGLCYLFRQNLQGPMLQGRPGFQECIKGNVDLVFLFDGSMSLQPDEFQKILDFM
KDVMKKLSNTSYQFAAVQFSTSYKTEFDFSDYVKRKDPDALLKHVKHMLLLTNTFGAINY
VATEVFREELGARPDATKVLIIITDGEATDSGNIDAAKDIIRYIIGIGKHFQTKESQETL
HKFASKPASEFVKILDTFEKLKDLFTELQKKIYVIEGTSKQDLTSFNMELSSSGISADLS
RGHAVVGAVGAKDWAGGFLDLKADLQDDTFIGNEPLTPEVRAGYLGYTVTWLPSREKTSL
LASGAPRYQHVGRVLLFQEPQGGGHWSQVQTIHGTQIGSYFGGELCGVDVDQDGETELLL
TGAPLFYGEQRGGRVFIYQRRQLGFEEVSELQGDPGYPLGRFGEAITALTDINGDGLVDV
AVGAPLEEQGAVYIFNGRHGGLSPQPSQRIEGTQVLSGIRWFGRSIHGVKDLEGDGLADM
AVGAESQMILLSSRPVVDVVTLMSFSPAEIPVHEVECSYSTSNKMKEGVNITICFQIKSL
IPQFQGRLVANLTYTLQLDGHRTRRRGLFPGGRHELRRNIAVTTSMSCTDFSFHFPVCVQ
DLISPINVSLNFSLWEEEGTPREQRAQGKDIPPILRPSLHSETWEIPFEKNCGEDKKCEA
NLRVSFSPARSRALRLTAFASLSVELSLSNLRDAYWVQLLHFPPHSQIPVSCEELPEESK
LLSRALSCNVSSPIFKAGHSVALQMMFNTLVNSSWGDSVELQANVTCNNEDSGLLEDNSA
TTIIPILYPINVLIQVRIQPSIHDHNIPTLEAVVGVPQPPSEGPITHQWSVQMEPPVPCH
YEELKRLPDAAEPCLPGALFRCPVVFRQEILVQVIGTLELVGEIEASSMFSLCSSLSISF
NSSKHFHLYGSNASLAQVIMKVDVVYEKQMLYLYVLSGIGGLLLLLLIFIVLYKVGFFKR
NLKEKMEAGGGVPNGIPAEDSEQLASGEEAGDPGCLKPLHEEDSESGSGKD
Download sequence
Identical sequences H2NQN6
ENSPPYP00000008221 ENSPPYP00000008221 9600.ENSPPYP00000008221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]