SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000008223 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000008223
Domain Number 1 Region: 277-334
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.99e-25
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 2 Region: 362-418
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.36e-21
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 3 Region: 418-474
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.62e-20
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 4 Region: 239-291
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.96e-20
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 5 Region: 463-515
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.02e-19
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 6 Region: 324-355
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000092
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000008223   Gene: ENSPPYG00000007277   Transcript: ENSPPYT00000008562
Sequence length 520
Comment pep:known_by_projection chromosome:PPYG2:16:29037302:29039351:-1 gene:ENSPPYG00000007277 transcript:ENSPPYT00000008562 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSPEGSLRGNMSENEEEEISQQEGTGDYEVEEIPFGLEPQSPGFELQSPEFEPQSPRFE
PESPGFESRSPGLVPPSPEFAPRSPESDSQSPEFETQSPRYEPQSPGYEPRSPGYEPRSP
GYESESSRYESQNPELKTQSPEFEAQSSKFQEGAEMLLNPEEKSPLNISVGVHPLDSFTQ
GFGEQPTEDLPIGPPFEMPTGALLSTPQFEMLQNPLGLTGALRGPGRRGGRARGGQGPRP
NICGICGKSFGRGSTLIQHQRIHTGEKPYKCEVCSKAFSQSSDLIKHQRTHTGERPYKCP
RCGKAFADSSYLLRHQRTHSGQKPYKCPHCGKAFGDSSYLLRHQRTHSHERPYSCTECGK
CYSQNSSLRSHQRVHTGQRPFSCGICGKSFSQRSALIPHARSHAREKPFKCPECGKRFGQ
SSVLAIHARTHLPGRTYSCPDCGKTFNRSSTLIQHQRSHTGERPYRCAVCGKGFCRSSTL
LQHHRVHSGERPYKCDDCGKAFSQSSDLIRHQRTHAAGRR
Download sequence
Identical sequences H2NQN8
ENSPPYP00000008223 9600.ENSPPYP00000008223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]