SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000008235 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000008235
Domain Number 1 Region: 438-495
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.44e-26
Family Classic zinc finger, C2H2 0.0027
Further Details:      
 
Domain Number 2 Region: 186-243
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.03e-26
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 3 Region: 382-439
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.83e-25
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 4 Region: 242-299
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.08e-24
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 5 Region: 299-355
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.57e-23
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 6 Region: 148-200
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.05e-20
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 7 Region: 480-532
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.75e-18
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 8 Region: 751-795
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000654
Family Classic zinc finger, C2H2 0.042
Further Details:      
 
Domain Number 9 Region: 345-377
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000182
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 10 Region: 565-598
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000404
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 11 Region: 659-693
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000478
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 12 Region: 711-738
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000228
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 13 Region: 840-869
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000168
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000008235   Gene: ENSPPYG00000007288   Transcript: ENSPPYT00000008574
Sequence length 872
Comment pep:known_by_projection chromosome:PPYG2:16:29294045:29303131:-1 gene:ENSPPYG00000007288 transcript:ENSPPYT00000008574 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPETALWGPDLQGPEQSPNDAHRGAESENEEDSPRQESSGEEIIMGDPAQSPESKDSTE
MSLERPSQDPSVPQNPPTPLGHSNPLDHQTPLDPPAPEVVPTPSDWTKACEASWQWGALT
TWNSPPVVPANEPSLRELVQGRPAGAEKPYICNECGKSFSQWSKLLRHQRIHTGERPNTC
SECGKSFTQSSHLVQHQRTHTGEKPYKCPDCGKCFSWSSNLVQHQRTHTGEKPYKCTECE
KAFTQSTNLIKHQRSHTGEKPYKCGECRRAFYRSSDLIQHQATHTGEKPYKCPECGKRFG
QNHNLLKHQKIHAGEKPYRCTECGKSFIQSSELTQHQRTHTGEKPYECLECGKSFGHSST
LIKHQRTHLREDPFKCPVCGKTFTLSATLLRHQRTHTGERPYKCPECGKSFSVSSNLINH
QRIHRGERPYICADCGKSFIMSSTLIRHQRIHTGEKPYKCSDCGKSFIRSSHLIQHRRTH
TGEKPYKCPECGKSFSQSSNLITHVRTHMDENLFVCSDCGKAFLEAHELEQHRVIHERGK
TPARRAQGDTLLGLGDPSLLTPPPGAKPHKCLVCGKGFNDEGIFMQHQRIHIGENPYKNA
DGLIAHAAPKPPQLRSPRLPFRGNSYPGAAEGRAEAPGQPLKPPEGQEGFSQRRGLLSSK
TYICSHCGESFLDRSVLLQHQLTHGNEKPFLFPDYRIGLGEGAGPSPFLSGKPFKCPECK
QSFGLSSELLLHQKVHAGGKSSQKSPELGKSSSVLLEHLRSPLGARPYSCSDCRASFLDR
VALTRHQETHTQEKSPSPEDPPPEAVTLSTDQEGEGEAPTPTESSSHGEGEEGENPKTLV
EEKPYLCPECGDGFTEVAALLLHRSCHPGVSL
Download sequence
Identical sequences H2NQQ0
ENSPPYP00000008235 ENSPPYP00000008235 XP_002826402.1.23681 XP_009248933.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]