SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000008262 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000008262
Domain Number 1 Region: 1-87
Classification Level Classification E-value
Superfamily DEATH domain 2e-18
Family Pyrin domain, PYD 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000008262   Gene: ENSPPYG00000007314   Transcript: ENSPPYT00000008601
Sequence length 89
Comment pep:known_by_projection chromosome:PPYG2:16:29753651:29753920:-1 gene:ENSPPYG00000007314 transcript:ENSPPYT00000008601 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTKREAILKVLENPTPEELKKFKIKLGMVPLSEGFERIPRGALGQLDIVDLTDKLVASY
YEDYAAELVVAVLRDMRMLKEAARLQRAA
Download sequence
Identical sequences H2NQS7
XP_002826424.1.23681 ENSPPYP00000008262 ENSPPYP00000008262 9600.ENSPPYP00000008262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]