SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000008263 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000008263
Domain Number 1 Region: 16-122,311-615
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 6.28e-68
Family Integrin alpha N-terminal domain 0.0000669
Further Details:      
 
Domain Number 2 Region: 104-333
Classification Level Classification E-value
Superfamily vWA-like 2.82e-49
Family Integrin A (or I) domain 0.000000019
Further Details:      
 
Domain Number 3 Region: 615-771
Classification Level Classification E-value
Superfamily Integrin domains 4.71e-29
Family Integrin domains 0.0082
Further Details:      
 
Domain Number 4 Region: 772-887
Classification Level Classification E-value
Superfamily Integrin domains 2.04e-23
Family Integrin domains 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000008263   Gene: ENSPPYG00000007315   Transcript: ENSPPYT00000008602
Sequence length 1014
Comment pep:known_by_projection chromosome:PPYG2:16:29805497:29886899:1 gene:ENSPPYG00000007315 transcript:ENSPPYT00000008602 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASQVTRITALTLCHGFNLDTENTMTFQENARGFGQSVVQLQGSRVVVGAPQEIVAANQRG
SLYQCDYSTGSCEPIRLQVPVEAVNMSLGLSLAATTSPPQLLACGPTVHQTCSENTYVKG
LCFLFGSNLRQQPQKLPEALRGCPQVDSDIAFLIDGSGSINPNDFRQMKEFVSTVMEQLK
KSKTLFSLMQYSEEFRIHFTFKEFQKNPNPRSLVKPIVQLLGRTHTATGIRKVVRELFNI
THGARKNAFKILVVITDGEKFGDPLGYEDVIPEADREGVIRYVIGVGDAFRSEKSRQELN
TIASKPARDHVFRVNNFEALKTIQNQLREKIFAIEGTQTGSSSSFEHEMSQEGFSAAITS
NGPLLSTVGSYDWAGGAFLYTSKEKSTFINMTRVDSDMNDAYLGYAAAIILRNRVQSLVL
GAPRYQHIGLVVMFRQNAGMWESNANVKGTQIGAYFGASLCSVDVDSNGSTDLVLIGAPH
YYEQTRGGQVSVCPLPRGRARWQCDAVLYGEQGQPWGRFGAALTVLGDVNGDKLTDVAIG
APGEEDNRGAVYLFHGTSGFGISPSHSQRIAGSKLSPRLQYFGQSLSGGQDLTMDGLVDL
TVGAQGHVLLLRSQPVLRVKAIMEFNPREVARNVFECNDQVVKGKEAGEVRVCLHVQKST
RDRLREGQIQSVVTYDLALDSGRPRSRAVFSETKNSTRRRTEVLGLTQTCETLKLQLPNC
IEDPVSPIVLRLNFSLVGTPLSAFGNLQPVLAEDAQRLFTALFPFEKNCGNDNICQDDLS
ITFSFMSLDCLVVGGPREFNVTVTVRNDGEDSYRTQVTFFFPLGLSYRKVSRLQNQYSRR
SWRLACESASSTEVSGALKSASCSINHPIFPENSEENNMPRTNKTEFQLELPVKYAVYMV
VTSHEVSTKYLNFTASENTSRVMQHQYQVSNLGQRSLPISLVFLVPVRLNQAIIWDRPQV
TFSEPNPLPLIVGSSVGGLMLLALITAALYKLGFFKRQYKDMMSEGGPPGAEPQ
Download sequence
Identical sequences H2NQS8
ENSPPYP00000008263 9600.ENSPPYP00000008263 ENSPPYP00000008263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]