SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000008271 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000008271
Domain Number 1 Region: 43-158
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.03e-33
Family Spermadhesin, CUB domain 0.00021
Further Details:      
 
Domain Number 2 Region: 173-294
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.15e-17
Family Spermadhesin, CUB domain 0.003
Further Details:      
 
Domain Number 3 Region: 296-332
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000864
Family LDL receptor-like module 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000008271   Gene: ENSPPYG00000007323   Transcript: ENSPPYT00000008610
Sequence length 525
Comment pep:known_by_projection chromosome:PPYG2:16:33988544:34049438:-1 gene:ENSPPYG00000007323 transcript:ENSPPYT00000008610 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AKERLCSVLKVLLITVLVVEGIAVAQKTQDGQNIGIKHIPATQCGIWVRTSNGGHFASPN
YPDSYPPNKECIYILEAAPRQRIELTFDEHYYIEPSFECRFDHLEVRDGPFGFSPLIDRY
CGVKSPPLIRSTGRFMWIKFSSDEELEGLGFRAKYSFIPDPDFTYLGGILNPIPDCQFEL
SGADGIVRSSQVEQEEKTKPGQAVDCIWTIKATPKAKVLLCIEDYQNGSTQMKCKRNFVA
VYDGSSSIENLKAKFCSTVANDVMLKTGIGVIRMWADEGSRLSRFRMLFTSFCGAPCTSS
TFFCHSNMCINNSLVCNGVQNCAYPWDENHCKEKKKAGVFEQITKTHGTIIGVTSGIVLV
LLIISILVQVKQPRKKVMACKTAFNKTGFQEVFDPPHYELFSLRDKEISADLADLSEELD
NYQKMRRSSTASRCIHDHHCGSQASSVKQSRTNLSSMELPFGNDFAQPQPMKTFNSTFKK
SSYTFKQGHECPEQALEDRVMEEIPCEIYVRGREDSAQASISIDF
Download sequence
Identical sequences H2NQT6
ENSPPYP00000008271 9600.ENSPPYP00000008271 ENSPPYP00000008271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]