SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000008406 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000008406
Domain Number 1 Region: 79-227
Classification Level Classification E-value
Superfamily TRADD, N-terminal domain 1.44e-19
Family TRADD, N-terminal domain 0.0000597
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000008406   Gene: ENSPPYG00000007440   Transcript: ENSPPYT00000008749
Sequence length 234
Comment pep:known_by_projection chromosome:PPYG2:16:54516385:54522595:-1 gene:ENSPPYG00000007440 transcript:ENSPPYT00000008749 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFARGRGLAAEDSGREAATGSPRGRDARADGAARARAPPQRLRAHPEAARVERSLAGVG
TRAPPRRPGGEMAAGQNGHEEWVGSAYLFVESSLDKVVLSDAYAHPQQKVAVYRALQAAL
AESGGSPDVLQMNRPLSLQDQQTFARSVGLKWRKVGRSLQRGCRALRDPALDSLAYEYER
EGLYEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSLAEDLLGLTDPNGGLA
Download sequence
Identical sequences H2NR60
ENSPPYP00000008406 ENSPPYP00000008406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]