SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000008452 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000008452
Domain Number 1 Region: 462-551
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.28e-16
Family Canonical RBD 0.0016
Further Details:      
 
Domain Number 2 Region: 241-331
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000000000019
Family Canonical RBD 0.0007
Further Details:      
 
Domain Number 3 Region: 344-437
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000163
Family Canonical RBD 0.001
Further Details:      
 
Domain Number 4 Region: 51-192
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0000493
Family DnaQ-like 3'-5' exonuclease 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000008452   Gene: ENSPPYG00000007484   Transcript: ENSPPYT00000008796
Sequence length 717
Comment pep:known_by_projection chromosome:PPYG2:16:55616920:55627991:-1 gene:ENSPPYG00000007484 transcript:ENSPPYT00000008796 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPPPPPPPPPGPDPAADPTADPCPWPGSLVVLFGATAGALGRDLGSDETDLILLVWQVV
EPRSRQVGTLHKSLVRAEAAALSTQCREASGLSADSLARAEPLDKVLQQFSQLVNGDVAL
LGGGLYMLCTDGQQLLRQVLHPEASRKNLVLPDMFFSFYDLRREFHTQHPSTCPARDLTV
ATMAQDLGLETDATEDDFGVWEVKTMVAVILHLLKEPSSQLFSKPEVIKQKYETGPCSKA
DVVDSETVVRARGLPWQSSDQDVARFFKGLNVARGGVALCLNAQGRRNGEALIRFVDSEQ
RDLALQRHKHHMGVRYIEVYKATGEEFVKIAGGTSLEVARFLSREDQVILRLRGLPFSAG
PTDVLGFLGPECPVTGGAEGLLFVRHPDGRPTGDAFALFACEELAQAALRRHKGMLGKRY
IELFRSTAAEVQQVLNRYASGPVLPTLTAPLLPIPFPLAPGTGRDCVRLRGLPYTATIED
ILSFLGEAAADIRPHGVHMVLNQQGRPSGDAFIQMTSAERALAAAQRCHKKVMKERYVEV
VPCSTEEMSRVLMGGTLGRSGMSPPPCKLPCLSPPTYTTFQATPTLIPTETAALYPSSAL
LPAARVPAAPTPVAYYPGPATQLYLNYTAYYPSPPVSPTTVGYLTTPTAALASAPTSVLS
QSGALVRMQGVPYTAGMKDLLSIFQAYQLPADDYTSLMPVGDPPRTVLQAPKEWVCL
Download sequence
Identical sequences H2NRA6
XP_002826613.1.23681 9600.ENSPPYP00000008452 ENSPPYP00000008452 ENSPPYP00000008452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]