SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000008503 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000008503
Domain Number 1 Region: 241-298
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.93e-25
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 2 Region: 185-242
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.39e-23
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 3 Region: 297-354
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.59e-21
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 4 Region: 1-57
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.45e-21
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 5 Region: 147-199
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.85e-20
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 6 Region: 342-401
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.62e-19
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 7 Region: 391-426
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000882
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000008503   Gene: ENSPPYG00000007530   Transcript: ENSPPYT00000008850
Sequence length 446
Comment pep:known chromosome:PPYG2:16:60351592:60362821:1 gene:ENSPPYG00000007530 transcript:ENSPPYT00000008850 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVTFEDVAVHFTKTEWTGLSPAQRALYRSVMLENFGNLTALGYPVPKPALISLLEGGDMA
WGLEAQDDPLAETTKNVCKDVETNIDSESTLIQGISEERDGMMSHGQLKSVPQRTDFPET
CNVEKHQDIPTVKNIRGKVPRIPCARKPFICEECGKSFSYFSYYARHQRIHTGEKPFECS
ECGKAFNGNSSLIRHQRIHTGEKPYHCEECGRAFNDNANLIRHQRIHSGDRPYYCTECGN
SFTSSSEFVIHQRIHTGEKPYECNECGKAFVGNSPLLRHQKIHTGEKPYECNECGKSFGR
TSHLSQHQRIHTGEKPYSCKVCGQAFNFHTKLTRHQRIHSEEKPFDCVDCGKAFSAQEQL
KRHLRIHTQESSYVCDECGKAFTSKRNLHQHQRIHTGEKPYEYSKYEKAFGTSSQLGHLE
HVHSGEKPVLDICRFGLPEFFTPFYW
Download sequence
Identical sequences H2NRF2
ENSPPYP00000008503 XP_009249189.1.23681 XP_009249190.1.23681 ENSPPYP00000008503 9600.ENSPPYP00000008503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]