SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000008504 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000008504
Domain Number 1 Region: 374-430
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.06e-25
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 2 Region: 290-346
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.85e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 513-570
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.63e-24
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 4 Region: 429-486
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.04e-24
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 5 Region: 233-290
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.51e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 6 Region: 178-234
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-19
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 7 Region: 555-607
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.28e-19
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 8 Region: 588-641
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000196
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 9 Region: 336-368
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000375
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 10 Region: 476-508
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000414
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 11 Region: 122-173
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000506
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000008504
Domain Number - Region: 1-27
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0017
Family KRAB domain (Kruppel-associated box) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000008504   Gene: ENSPPYG00000007531   Transcript: ENSPPYT00000008851
Sequence length 644
Comment pep:known chromosome:PPYG2:16:60374630:60388983:1 gene:ENSPPYG00000007531 transcript:ENSPPYT00000008851 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLENYGNVASLGFPLLKPAVISQLEGGGELGGPSPLAAGRGLQGLRTVDIQTDNDLTKEM
YERKENVSFELQRDFSQETDFSEASLLEKQQEVYSAGNIKKEKSSTIDGTVKDETSPVEE
CFFSQSSNSYQCHTITGEQPSGCAGLGKSISFDTKLVKHEIINSEERPFKCEELVEPFRC
DSQLTQHQENNTEEKPYQCSECGKAFSINEKLIWHQRLHSGEKPFKCVECGKSFSYSSHY
ITHQTIHSGEKPYQCKVCGKAFSVNGSLSRHQRIHTGEKPYQCKECGNGFSCSSAYITHQ
RVHTGEKPYECNDCGKAFNVNAKLIQHQRIHTGEKPYECNECGKGFRCSSQLRQHQSIHT
GEKPYQCKECGKGFNNNTKLIQHQRIHTGEKPYECTECGKAFSVKGKLIQHQRIHTGEKP
YECNECGKAFRCNSQFRQHLRIHTGEKPYECNECGKAFSVNGKLMRHQRIHTGEKPFECN
ECGRCFTSKRNLLDHHRIHTGEKPYQCKECGKAFSINAKLTRHQRIHTGEKPFKCMECEK
AFSCSSNYIVHQRIHTGEKPFQCKECGKAFHVNAHLIRHQRSHTGEKPFRCVECGKGFSF
SSDYIIHQTVHTWKKPYMCSVCGKAFRFSFQLSQHQSVHSEGKS
Download sequence
Identical sequences H2NRF3
XP_009249183.1.23681 ENSPPYP00000008504 ENSPPYP00000008504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]