SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000008546 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000008546
Domain Number 1 Region: 294-496
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.29e-54
Family Reprolysin-like 0.00026
Further Details:      
 
Domain Number 2 Region: 586-643
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 8.5e-17
Family TSP-1 type 1 repeat 0.00027
Further Details:      
 
Domain Number 3 Region: 1127-1177
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000127
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 
Domain Number 4 Region: 930-991
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000497
Family TSP-1 type 1 repeat 0.0037
Further Details:      
 
Domain Number 5 Region: 994-1048
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000068
Family TSP-1 type 1 repeat 0.0034
Further Details:      
 
Domain Number 6 Region: 1054-1115
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000824
Family TSP-1 type 1 repeat 0.003
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000008546
Domain Number - Region: 883-931
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000432
Family TSP-1 type 1 repeat 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000008546   Gene: ENSPPYG00000007572   Transcript: ENSPPYT00000008894
Sequence length 1221
Comment pep:known_by_projection chromosome:PPYG2:16:64773462:64932302:-1 gene:ENSPPYG00000007572 transcript:ENSPPYT00000008894 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MECALLLACALPAAGSGPPRGPAGLGRVAKALQLCCLCCASVAAALASDSSSGASGLNDD
YVFVTPVEVDSAGSYISHDILHNGRKKRSAQNARNSLHYRFSAFGQELHLELKPSAILSS
HFIVQVLGKDGASETQKPEVQQCFYQGFIRNDSSSSVAVSTCAGLSGLIRTRKNEFLISP
LPQLLAQEHNYSSPAGHHPHVLYKRTAEEKVQGYRGYPGSGRNYPGYSPSHIPHASQSQE
TEYHHRRSQKQHFCGRRKKYAPKPPTEDTYLRFDEYGSSGRPRRSAGKSQKGLNVETLVV
ADKKMVEKHGKGNVTTYILTVMNMVSGLFKDGTIGSDINVVVVSLILLEQEPGGLLINHH
ADQSLNSFCQWQSALIGKNGKRHDHAILLTGFDICSWKNEPCDTLGFAPISGMCSKYRSC
TINEDTGLGLAFTIAHESGHNFGMIHDGEGNPCRKAEGNIMSPTLTGNNGVFSWSSCSRQ
YLKKFLSTPQAGCLVDEPKQGGQYKYPDKLPGQIYDADTQCKWQFGAKAKLCSLGFVKDI
CKSLWCHRVGHRCETKFMPAAEGTVCGLSMWCRQGQCVKFGELGPRPIHGQWSAWSKWSE
CSRTCGGGVKYQERHCNNPKPQYGGKFCPGSSRIYQLCNINPCNENSLDFRAQQCAEYNS
KPFRGWFYQWKPYTKVEEEDRCKLYCKAENFEFFFAMSSKVKDGTPCSPNKNDVCIDGVC
ELVGCDHELGSKAVSDACGVCKGDNSTCKFYKGLYLNQHKANEYYPVVIIPAGARSIEIQ
ELHVSSSYLAVRSLSQKYYLTGGWSIDWPGEFPFAGTMFEYQRSFNLPERLYAPGPTNET
LVFEILMQGKNPGIAWKYALPKVVNGTPPATKRPAYAWSIVQSECSVSCGGGYINVKAIC
LRGQNTQVNSSFCSARTKPVTEPKICNAFSCPAYWMPGEWSTCSKSCAGGQQSRKIQCVQ
KKPFQKEEAVLHSLCPVSTPTQVQACNSHACPPEWSLGPWSQCSKTCGRGVRKRELLCKG
SATETLPESQCTSLPRPELQEGCVLRRCPKNNRLQWVASSWSECSATCGLGVRKREMKCS
EKGFQGKLITFPERRCRNIKKPNLDLEETCNRRACPAHPVYNVGAGWYSSPWQQCTVTCG
GGVQTRSVHCVQQGRPSSSCLLHQKPPVLRACNTNFCPAPEKREDPSCVDFFNWCHLVPQ
HGVCNHKFYGKQCCKSCTRKI
Download sequence
Identical sequences H2NRJ5
ENSPPYP00000008546 XP_009249241.1.23681 ENSPPYP00000008546 9600.ENSPPYP00000008546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]