SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000008549 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000008549
Domain Number 1 Region: 52-195
Classification Level Classification E-value
Superfamily C-type lectin-like 1.21e-33
Family C-type lectin domain 0.0000234
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000008549   Gene: ENSPPYG00000007575   Transcript: ENSPPYT00000008897
Sequence length 197
Comment pep:known_by_projection chromosome:PPYG2:16:65560804:65570607:1 gene:ENSPPYG00000007575 transcript:ENSPPYT00000008897 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKNGLVICILVITLLLDQTTSHASRLKARKHSKRRVRDKDGDLKTQIEKLWTEVNALKE
MQALQTVCLRGTKVHKKCYLASEGLKHFHEANEDCISKGGILVIPRNSDEINALQDYGKR
SLPGVNDFWLGINDMVTEGKFVDVNGIAISFLNWDRAQPNGGKRENCVLFSQSAQGKWSD
EACRSSKRYICEFTIPQ
Download sequence
Identical sequences H2NRJ8
ENSPPYP00000008549 XP_002826710.1.23681 9600.ENSPPYP00000008549 ENSPPYP00000008549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]