SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000008558 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPPYP00000008558
Domain Number - Region: 5-28
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0976
Family Classic zinc finger, C2H2 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000008558   Gene: ENSPPYG00000007583   Transcript: ENSPPYT00000008906
Sequence length 667
Comment pep:known_by_projection chromosome:PPYG2:16:68708213:68714180:1 gene:ENSPPYG00000007583 transcript:ENSPPYT00000008906 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKMHAEKKHKCSKCSNSYGTEWDLKRHAEDCGKTFRCTCGCPYASRTALQSHIYRTGHEI
PAEHRDPPSKKRKMENYAQNQKLSNKTIESLNNQPIPRPDTQELEASEIKLEPSFEDSCG
SNTDKQTLTTPPRYPQKLLLPKPKVALVKLPVMQFSLMPVFVPTADSSAQPVVLGVDQGS
ATGAVHLLPLSVGTLILGLDSEACSLKESLPLFKIANPIAGEPISTGVQVNFGKSPSNPL
QELGNTCQKNSISSINVQTDLSYASQNFIPSAQWATADSSVSSCSQTDLSFDSQVSLPIS
VHTQTFLPSSKVTSSIAAQTDAFMDTCFQSVGVSRETQTSGIESPTDDHVQMDQAGMCGD
IFESVHSSYNVATGNIISNSLVAETVTHSLLPQNEPKTLNQDIEKSAPIINFSAQNSMLP
SQNMTDNQTQTIDLLSDLENILSSNLPAQTLDHRSLLSDTNPGPDTQLPSGPAQNPGIDF
DIEEFFSASNIQTQTEESELSTMNTEPVLESLDIETQTDFLLADTSAQSYGCRGNSNFLG
LEMFDTQTQTDLNFFLDSSPHLPLGSILKHSSFSMSTDSSDTETQTEGISTAKNTPALES
KVQLNSTETQTMSSGFETLGSLFFTSNETQTAMDDFLLADLAWNTMESQFSSVETQTSAE
PHTVSNF
Download sequence
Identical sequences H2NRK7
ENSPPYP00000008558 ENSPPYP00000008558 XP_009249253.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]