SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000008614 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000008614
Domain Number 1 Region: 1861-1906
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000652
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000008614
Domain Number - Region: 1635-1672
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00116
Family Classic zinc finger, C2H2 0.039
Further Details:      
 
Domain Number - Region: 963-1018
Classification Level Classification E-value
Superfamily Expressed protein At2g23090/F21P24.15 0.00209
Family Expressed protein At2g23090/F21P24.15 0.0096
Further Details:      
 
Domain Number - Region: 1937-1963
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0182
Family Classic zinc finger, C2H2 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000008614   Gene: ENSPPYG00000007636   Transcript: ENSPPYT00000008962
Sequence length 2476
Comment pep:known_by_projection chromosome:PPYG2:16:76025461:76032954:1 gene:ENSPPYG00000007636 transcript:ENSPPYT00000008962 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ADPPQKTVPSDPPYPSFLLLEEVSPMLPSHFPDLSGGKVLSKTCPPEQTVAPGAAPSLPG
KGSGCSVALMSHLSEDELEIQKLVTELESQLQRSKDTHGAPRELGEAESVGRMELGTGTE
PPSQRRTCQATAPHKDTFSAAELTCVGEPAAHRDGAASAVATVERVQGGPRGTWPCPASF
HLRDAALLSCAHEDLVSGAPFSPRGANFQFQPVQKAGASKTGLCQAEGDSGPPTDVCLPD
PSKQPGPQLDAGSLVKCSPDQELSFPKNKEAASSQESEDSLRPLPCEQRGGFLPEPGTAE
QPHREAPAPEAFGSPAVHLAPDLAFQGDGAPPLDATWPFGASPSHAAQGHSAGRAGGHLH
PTAGRPGFEGNEFAPAGASSLTAPRGREAWLVPVPSPACVSNTHPSRRSQDPALSPPICQ
LQLPGPGVAESKDGILGLQELTPAAQSPPRVNPSGLERGTVERGKVACGPAQGSPGGVQV
TTLPAVAGHQLGLQADGHRGLLGQAEKTQGQGTANWLQPENGVSPVGTDNHASVNASPKT
ALASPAKGAVLLEKRKGSRTAMSLQEEAQPTPSPPSPDRESLALALTAAHTRNGSEGRTP
ERASSPSLNKPPLATGDSPAPSVGDLAACAPSPTSATRMPCSLGPLPHEDPLTSPSSATR
AQGGLGGQLPASPSCKDPPGPQHLLACSPAWAPLEEADGVRATTDTAGAEDSPMAPLSLT
TSPCDPKEALARCLLQGEGSPLEDPSSWHPGSVSAVTCTHGGDSPKDNTLRIPEDSRKEK
LWESPGRATSPPLAGAVSPSVIVRAAGLSSTPTEDEAQAGRGLPGPDPQSRGAPPHTNPD
RMPTGHSSYSPSNTARLGHREGQAVTAVPTEPPMLQGAGPDSPACLEGEMGTSSKEPEDP
GTPEIGRSGVTKMPRVTCPSTGLCLGRTTAPSSTASDFQSDSPQSHRNASHQTPQGDPLS
PQDLKQRPRGYKKKPASTENGQWKGQAPHGPVTCEVCAASFRSGPGLSRHKARKHRPHPG
APAEPSPEALPAQQPLEPLAQKCQPPRKKSRKVPGKERPNHSRGDPSHVTQPPPAQGSKE
VLRTPGSPHSQQLHPPSPTEHEVDVKTPASKPTPDQAREDELHPKQAEKREGRRWRREPT
VDSPSHSEGKSNKKRGKPRGRRLREESALPLSPDVISDGRGSRPSPAMASYAAPPSHCLS
VEGGPEADGEQPPRLATPGPGVMEGAAETDLEALCAGETGAQKPPGDRMLCPGRMDGAAL
GEQPAGQKGASARGFWGPRETKALGVCKESRSEPAEDSSGAHSRSEEGIWEEKTTPLGPL
GFPETSSSPADSTTSSCLQGLPDNPDTQGGVQGPEAPTPDASGSGSNAKDPPSLFDDEVS
FSQLFPPGGRLTRKRNPRVYGKRCEKPVRSLPTQPSFEEGGGPTLGPARLPTDLSDSGSL
CLCHEDPWEDEDPAGLPESFLLDGFLNSRVPGIDPWAPGLSLWALESSRETGAEKLPSHC
PEDDRPEAIPELHMVPASWRGLELPAPADDSSSSLGDVSPEPPSLERERCDGGLPGNTHL
LPLRAADFEVLSTKFEMQDLCFLGPFEDPVGLPGPSFLDFEATASSQGPQSRRTEEAAGA
GRAQGRGRPAKGKRASYKCRVCFQRFRSLGELDLHKLAHTPAPPPTCYMCVERRFGSREL
LRGHLQERHAQSKAGPWACGMCLKEVADVWMYNEHLREHAARFARRGQARRSLGDPSGGL
EGSGAIAHLLNSIMEPAPKHHRGKRSAGKAAGSPGDPCGQEGEARKESPGERAKPRARST
PSNPDGAATPDGASANALADAGSPGPPKTTPGPSPDPWAGGEPLLQATPVHEACKDPSRD
CHHCGKRFPKPFKLQRHLAVHSPQRVYLCPRCPRVYPEHGELLAHLGGAHGLRERPELQH
TPLYACELCATVMRIIKKSFACSSCNYTFAKKEQFDRHMDKHLRRGRQPFTFRGVRRPGA
PGQKARALEGTLPSKRRRVAMPGSAPGPSEDRPLPRGSSPILSEGSLPALLHLCSEVAPS
TTKGWPETLERPVDPVTHPIRGCDLPSNHQECPPPSLSPFPAALADGRGNCVLEGALERP
ENEASPGSPGPLLQQALPLGASVPRPGARSQDAEGKRAPLLFSGKRRAPGARGRCTPDHF
QEDHTLLQKEKEVSSSHMVSEGGPGGAFHKGSATKPAGCQSSSKDRSAASTPSKALKFPV
HPRKAVGSLAPGELARGTENGMKPATPKAKPGPSSQGSGSPCPGTKTGGGSQPQPASGQL
QSETATTPAKPSFPSRSPAPDRLPPRAQAKSCTKGTREAGEQGPHGSPGPKEKGESSMKR
RKGQVPGPTRSESVGSFGRAPSAPDKPPRTPRKQATPSRVLPTKPKPNSQNKPRPPPSEQ
RKAEPGHTHRKDRLGKAFPQGRPLLRPPKRGTAVHGAEPAEPHTHRTAEAQSDLLSQLFG
QRLTGFKIPLKKDASE
Download sequence
Identical sequences H2NRR2
9600.ENSPPYP00000008614 ENSPPYP00000008614 ENSPPYP00000008614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]