SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000008751 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000008751
Domain Number 1 Region: 65-125
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000131
Family HLH, helix-loop-helix DNA-binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000008751   Gene: ENSPPYG00000007767   Transcript: ENSPPYT00000009109
Sequence length 235
Comment pep:known_by_projection chromosome:PPYG2:17:1120110:1120817:1 gene:ENSPPYG00000007767 transcript:ENSPPYT00000009109 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRGAPGLGLRARKGAEGSAEDLGGPCPEPGGDLGVLGANGASCSRGEAEEPAGRRRARP
VRSKARRMAANVRERKRILDYNEAFNALRRALRHDLGGKRLSKIATLRRAIHRIAALSLV
LRASPAPRGPCGHLECHGPAACGDTGDTGASPPPPAGPSLARPDAARPSVPSAPRCASCP
PHAPLARPSAVAEGPGLAQVSGGSWRRCPGASSAGPPPWPRGYLRSAPGMGHPRS
Download sequence
Identical sequences H2NS44
ENSPPYP00000008751 9600.ENSPPYP00000008751 ENSPPYP00000008751 XP_002826847.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]