SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000008792 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000008792
Domain Number 1 Region: 3-293
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 2.38e-74
Family Rhodopsin-like 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000008792   Gene: ENSPPYG00000007806   Transcript: ENSPPYT00000009152
Sequence length 294
Comment pep:known_by_projection chromosome:PPYG2:17:3182672:3183654:-1 gene:ENSPPYG00000007806 transcript:ENSPPYT00000009152 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGTNRTAVAEFILLGLVQTEETQSVVFVLLLFAYLVTIGGNLSILAAVLVEPKLHTPMYF
FLGNLSVLDVGCITVTVPAILDRLLSHQRTISYDACLSKLFFFHLLAGMDCFLLTTMAYD
RFLAICRPLTYSTRMSQTVQRMLVAVSWACAFTSALTHTVAMSALSFCGPNEVSHFYCDL
PQLFQLSCSSAQLNELLLFAVGFIMAGAALVLIVTSYSHVAAAVLRIRSVEGRKKAFSTW
GSHLTVVCLFYGTGIFNHMRLEEASNKDKGVGVFNTVINSMLNPLIYSLRNPDV
Download sequence
Identical sequences H2NS85
ENSPPYP00000008792 9600.ENSPPYP00000008792 ENSPPYP00000008792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]