SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000008807 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000008807
Domain Number 1 Region: 366-672
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.09e-52
Family Integrin alpha N-terminal domain 0.0000946
Further Details:      
 
Domain Number 2 Region: 196-389
Classification Level Classification E-value
Superfamily vWA-like 1.78e-43
Family Integrin A (or I) domain 0.0000342
Further Details:      
 
Domain Number 3 Region: 831-963
Classification Level Classification E-value
Superfamily Integrin domains 1.67e-28
Family Integrin domains 0.0044
Further Details:      
 
Domain Number 4 Region: 681-827
Classification Level Classification E-value
Superfamily Integrin domains 0.000000303
Family Integrin domains 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000008807   Gene: ENSPPYG00000007821   Transcript: ENSPPYT00000009168
Sequence length 1182
Comment pep:known_by_projection chromosome:PPYG2:17:3605120:3691851:-1 gene:ENSPPYG00000007821 transcript:ENSPPYT00000009168 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWLFHTLLCMASLAPLAAFNVDVARPWLTPKGGAPFVLSSLLHQDPSTNQTWLLVTSPRT
KRTPGPLHRCSLVQDEILCHPVEHVPIPKGRHRGVTVARSHHGVLICIQVLVRRPHSLSS
ELTGTCSLLGPDLRPQAQVNFFDLENLLDPDARVDTADCYSNKEGGGGEDVNTARWRRAL
EKEEEEDKEEEEDEEEEEAGTEIAIILDGSGSIDPPDFQRAKDFISNMMRNFYEKCFECN
FALVQYGGVIQTEFDLRDSQDVMASLARVQNITQVGSVTKTASAMQHVLDSIFTSSHGSR
RKASKVMVVLTDGGIFEDPLDLTTVINSPKMQGVERFAIGVGEEFKSARTERELNLIASD
PDETHAFKVTNYMALDGLLSKLRHNIISMEGTVGDALHYQLAQIGFSAEILDKRQVLLGA
VGAFDWSGGALLYDTRSRRGRFLNQTATAAATADAEAAQYSYLGYAVAVLHKTCSLSYVA
GAPRYKHHGAVFELQKEGREASFLPVLEGEQMGSYFGSELCPVDIDMDGTTDFLLVGAPF
YHVHGEEGRVYVYRLSEQDGSFSLARILSGHPGFTNARFGFAMAAMGDISQDKLTDVAIG
APLEGFGADDGASFGSVYIYNGHWDGLSTSPSQRIRASTVAPGLQYFGMSMAGSFDISGD
GLADITVALWAGQCVPFSSRPVVRLKASMAFNPSALPIGFNGVVNVRLCFEISSVTTASE
SGLRGAFLNFTLDVDVGKQRRRLQCSDGRSCLGCLREWSSGSQLCEDLLLMPTEGELCEE
DCFSNASVKVSYQLQTPEGQTDHPQPILDRYTEPFAIFQLPYEKACKDKLFCVAELQLAT
AVSQQELVVGLTKELTLNINLTNSGEDSYLTSMALNYPRNLQFKRMQKPPSPNIQCDDPQ
PVASVLIINCRIGHPVLKRSSAHVSVVWQLEENAFPNRTADITVTVTNSNERRSLANETH
TLQFRHAFVAVLSKPSITYVNTGQGLSHHKEFLFHIHGENLFGAEYQLQICVPTKLRGLQ
IATVKNLTRTQASTVCTWSQERACAYSSVQHVEDWHSVSCVIAADKENVTVAAEISLDHS
EELLKDVTELQIFGEISFNKSLYEGLNAENHRTKITVVFLKDEKYHSLPIIIKGSIGGLL
VLIVILVILFKCGFFKRKYQQLNLESIRKSQLKSENLLEEEN
Download sequence
Identical sequences H2NSA0
ENSPPYP00000008807 ENSPPYP00000008807 9600.ENSPPYP00000008807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]