SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000008879 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000008879
Domain Number 1 Region: 15-132
Classification Level Classification E-value
Superfamily POZ domain 1.88e-29
Family BTB/POZ domain 0.0000735
Further Details:      
 
Domain Number 2 Region: 363-419
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.72e-21
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 3 Region: 404-456
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.15e-17
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 4 Region: 324-376
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.07e-16
Family Classic zinc finger, C2H2 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000008879   Gene: ENSPPYG00000007891   Transcript: ENSPPYT00000009243
Sequence length 477
Comment pep:known_by_projection chromosome:PPYG2:17:7028846:7035749:1 gene:ENSPPYG00000007891 transcript:ENSPPYT00000009243 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSPAAPEGALGYVREFTRHSSDVLGNLNELRLRGILTDVTLLVGGQPLRAHKAVLIACS
GFFYSIFRGRAGVGVDVLSLPGGPEARGFAPLLDFMYTSRLRLSPATAPAVLAAATYLQM
EHVVQACHRFIQASYEPLGISLRPLEAEPPTPPTAPPPGSPRRSEGHPDPPTESRSCSQG
PPSPASPDPKACNWKKYKYIVLNSQASQAGSLVGERSSGQPCPQARLPSGDEASSSSSSS
SSEEGPIPGPQSRLSPTAATVQFKCGAPASTPHLLTSQAQDTSGSSSERARPLQGSEFFS
CQNCEAVAGCSSGLDPLVPGDEDKPYKCQLCRSSFRYKGNLASHRTVHTGEKPYHCSICG
ARFNRPANLKTHSRIHSGEKPYKCETCGSRFVQVAHLRAHVLIHTGEKPYPCPTCGTRFR
HLQTLKSHVRIHTGEKPYHCDPCGLHFRHKSQLRLHLRQKHGAATNTKVHYHILGGP
Download sequence
Identical sequences H2NSG8
9600.ENSPPYP00000008879 ENSPPYP00000008879 ENSPPYP00000008879 XP_002826978.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]