SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000008881 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000008881
Domain Number 1 Region: 27-428
Classification Level Classification E-value
Superfamily MFS general substrate transporter 2.88e-45
Family Glycerol-3-phosphate transporter 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000008881   Gene: ENSPPYG00000007893   Transcript: ENSPPYT00000009245
Sequence length 471
Comment pep:known_by_projection chromosome:PPYG2:17:7046775:7048790:-1 gene:ENSPPYG00000007893 transcript:ENSPPYT00000009245 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAPQRKHRRGGFSHRCFPTPQTAMTPQPAGPPDGGWGWVVAAAAFAINGLSYGLLRSLG
LAFPDLAEHFDRSAQDTAWISALALAVQQAASPVGSALSTRWGARPVVMVGGVLASLGFV
FSAFALSLLHLYLGLGLLAGSGWALVFAPALGTLSRYFSRRRVLAVGLALTGNGVFSLLL
APALQLLLDTFGWRGALLLLGAITLHLTPCGALLLPLALPGDPPAPPRSPLATLGLGLFT
RRAFSIFALGTALVGGGYFVPYVHLAPHALDRGLGGYGAALVVAVAAMGDAGARLLCGCL
ADQGWVPLPRLLAVFGALTGLGLWVVGLVPVVGGEESWGGPLLAAAVAYGLSAGSYAPLV
FGVLPGLVGIGGVVQATGLVMMLMSLGGLLGPPLSGFLRDETGDFTASFLVSGSLILSGS
FIYIGLPRALPSCGPASPPATPPPERGELLPAPQAVLLSPGGPGSTLDTTC
Download sequence
Identical sequences H2NSH0
ENSPPYP00000008881 9600.ENSPPYP00000008881 XP_002826980.1.23681 ENSPPYP00000008881

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]