SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000008936 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000008936
Domain Number 1 Region: 12-68
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000157
Family HLH, helix-loop-helix DNA-binding domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000008936   Gene: ENSPPYG00000007948   Transcript: ENSPPYT00000009302
Sequence length 225
Comment pep:known_by_projection chromosome:PPYG2:17:8141498:8144007:-1 gene:ENSPPYG00000007948 transcript:ENSPPYT00000009302 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVTRDRAENRDGPKMLKPLVEKRRRDRINRSLEELRLLLLERTRDQNLRNPKLEKAEILE
FAVGYLRERSRVEPPGVPRSPVQDAEALASCYLSGFRECLLRLAAFAHDASPAARAQLFS
ALHGYLRPKPPRPKPVDPRPPAPRPSLDPAAPALGPALHQRPPMHQGPPSPRCAWSPSLC
SPRAGDSGAPAPLTGLLPPPPPPHRQDGAPKAPPPPPPAFWRPWP
Download sequence
Identical sequences A0A2I3GQD3 H2NSM4
9600.ENSPPYP00000008936 ENSPPYP00000008936 ENSPPYP00000008936 XP_002827045.1.23681 XP_003274690.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]