SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000008953 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000008953
Domain Number 1 Region: 57-629,662-873
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.74e-292
Family Motor proteins 2.87e-16
Further Details:      
 
Domain Number 2 Region: 874-999
Classification Level Classification E-value
Superfamily Myosin rod fragments 4.71e-24
Family Myosin rod fragments 0.00023
Further Details:      
 
Domain Number 3 Region: 995-1109
Classification Level Classification E-value
Superfamily Myosin rod fragments 1.31e-21
Family Myosin rod fragments 0.0014
Further Details:      
 
Domain Number 4 Region: 1274-1388
Classification Level Classification E-value
Superfamily Myosin rod fragments 4.45e-18
Family Myosin rod fragments 0.0027
Further Details:      
 
Domain Number 5 Region: 1386-1488
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000000154
Family Myosin rod fragments 0.0064
Further Details:      
 
Domain Number 6 Region: 1098-1189
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000000183
Family Myosin rod fragments 0.0057
Further Details:      
 
Domain Number 7 Region: 31-64
Classification Level Classification E-value
Superfamily Myosin S1 fragment, N-terminal domain 0.0000118
Family Myosin S1 fragment, N-terminal domain 0.00082
Further Details:      
 
Domain Number 8 Region: 1583-1698
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000253
Family Myosin rod fragments 0.0041
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000008953
Domain Number - Region: 1783-1971
Classification Level Classification E-value
Superfamily Tropomyosin 0.00183
Family Tropomyosin 0.0032
Further Details:      
 
Domain Number - Region: 1498-1608
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00628
Family Myosin rod fragments 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000008953   Gene: ENSPPYG00000007963   Transcript: ENSPPYT00000009319
Sequence length 2007
Comment pep:known_by_projection chromosome:PPYG2:17:8491163:8649791:-1 gene:ENSPPYG00000007963 transcript:ENSPPYT00000009319 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQRTGLEDPERYLFVDRAVIYNPATQADWTAKKLVWIPSERHGFEAASIKEERGDEVMV
ELAENGKKAMVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKDRYYSGLIYTYSGL
FCVVINPYKNLPIYSENIIEMYRGKKRHEMPPHIYAISESAYRCMLQDREDQSILCTGES
GAGKTENTKKVIQYLAHVASSHKGRKDHNIPQESPKPVKHQGELERQLLQANPILESFGN
AKTVKNDNSSRFGKFIRINFDVTGYIVGANIETYLLEKSRAVRQAKDERTFHIFYQLLSG
AGEHLKSDLLLEGFNNYRFLSNGYIPIPGQQDKDNFQETMEAMHIMGFSHEEILSMLKVV
SSVLQFGNISFKKERNTDQASMPENTVAQKLCHLLGMNVMEFTRAILTPRIKVGRDYVQK
AQTKEQADFAVEALAKATYERLFRWLVHRINKALDRTKRQGASFIGILDIAGFEIFELNS
FEQLCINYTNEKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIERPANPPG
VLALLDEECWFPKATDKTFVEKLVQEQGSHSKFQKPRQLKDKADFCIIHYAGKVDYKADE
WLMKNMDPLNDNVATLLHQSSDRFVAELWKDEIQNIQRASFYDSVSGLHEPPVDRIVGLD
QVTGMTETAFGSAYKTKKGMFRTVGQLYKESLTKLMATLRNTNPNFVRCIIPNHEKRAGK
LDPHLVLDQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYEILTPNAIPKGFMDGKQACER
MIRALELDPNLYRIGQSKIFFRAGVLAHLEEERDLKITDIIIFFQAVCRGYLARKAFAKK
QQQLSALKVLQRNCAAYLKLRHWQWWRVFTKVKPLLQVTRQEEELQAKDEELLKVKEKQT
KVEGELEEMERKHQQLLEEKNILAEQLQAETELFAEAEEMRARLAAKKQELEEILHDLES
RVEEEEERNQILQNEKKKMQAHIQDLEEQLDEEEGARQKLQLEKVTAEAKIKKMEEEILL
LEDQNSKFIKEKKLMEDRIAECSSQLAEEEEKAKNLAKIRNKQEVMISDLEERLKKEEKT
RQELEKAKRKLDGETTDLQDQIAELQAQIDELKLQLAKKEEELQGALARGDDETLHKNNA
LKVVRELQAQIAELQEDFESEKASRNKAEKQKRDLSEELEALKTELEDTLDTTAAQQELR
TKREQEVAELKKALEEETKNHEAQIQDMRQRHATALEELSEQLEQAKRFKANLEKNKQGL
ETDNKELACEVKVLQQVKAESEHKRKKLDAQVQELHAKVSEGDRLRVELAEKASKLQNEL
DNVSTLLEEAEKKGIKFAKDAASLESQLQDTQELLQEETRQKLNLSSRIRQLEEEKNSLQ
EQQEEEEEARKNLEKQVLALQSQLADTKKKVDDDLGTIESLEEAKKKLLKDAEALSQRLE
EKALAYDKLEKTKNRLQQELDDLTVDLDHQRQVASNLEKKQKKFDQLLAEEKSISARHAE
ERDRAEAEAREKETKALSLARALEEALEAKEEFERQNKQLRADMEDLMSSKDDVGKNVHE
LEKSKRALEQQVEEMRTQLEELEDELQATEDAKLRLEVNMQAMKAQFERDLQTRDEQNEE
KKRLLIKQVRELEAELEDERKQRALAVASKKKMEIDLKDLEAQIETANKARDEVIKQLRK
LQAQMKDYQRELEEARASRDEIFAQSKESEKKLKSLEAEILQLQEELASSERARRHAEQE
RDELADEIANSASGKSALLDEKRRLEARIAQLEEELEEEQSNMELLNDRFRKTTLQVDTL
NAELAAERSAAQKSDNARQQLERQNKELKAKLQELEGAVKSKFKATISALEAKIGQLEEQ
LEQEAKERAAANKLVRRTEKKLKEIFMQVEDERRHADQYKEQMEKANARMKQLKRQLEEA
EEEATRANASRRKLQRELDDATEANEGLSREVSTLKNRLRRGGPISFSSSRSGRRQLHLE
GASLELSDDDTESKTSDVNETQPPQSE
Download sequence
Identical sequences H2NSP0
ENSPPYP00000008953 ENSPPYP00000008953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]