SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000008973 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000008973
Domain Number 1 Region: 59-839
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.43e-289
Family Motor proteins 9.37e-18
Further Details:      
 
Domain Number 2 Region: 840-964
Classification Level Classification E-value
Superfamily Myosin rod fragments 6.67e-28
Family Myosin rod fragments 0.00000143
Further Details:      
 
Domain Number 3 Region: 1238-1353
Classification Level Classification E-value
Superfamily Myosin rod fragments 1.65e-25
Family Myosin rod fragments 0.0064
Further Details:      
 
Domain Number 4 Region: 962-1072
Classification Level Classification E-value
Superfamily Myosin rod fragments 2.35e-23
Family Myosin rod fragments 0.0016
Further Details:      
 
Domain Number 5 Region: 1431-1553
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000000000000102
Family Myosin rod fragments 0.0057
Further Details:      
 
Domain Number 6 Region: 1732-1932
Classification Level Classification E-value
Superfamily Tropomyosin 0.000015
Family Tropomyosin 0.00075
Further Details:      
 
Domain Number 7 Region: 1070-1184
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000968
Family Myosin rod fragments 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000008973   Gene: ENSPPYG00000007980   Transcript: ENSPPYT00000009339
Sequence length 1936
Comment pep:known_by_projection chromosome:PPYG2:17:10481081:10513376:-1 gene:ENSPPYG00000007980 transcript:ENSPPYT00000009339 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSASSDAEMAVFGEAAPYLRKSEKERIEAQNKPFDAKTSVFVAEPKESYVKSTIQSKEGG
KITVKTEGGATLTVKEDQVFPMNPPKYDKIEDMAMMTHLHEPGVLYNLKERYAAWMIYTY
SGLFCVTVNPYKWLPVYKPEVVAAYRGKKRQEAPPHIFSISDNAYQFMLTDRENQSILIT
GESGAGKTVNTKRVIQYFATIAVTGEKKKDESGKMQGTLEDQIISANPLLEAFGNAKTVR
NDNSSRFGKFIRIHFGTTGKLASADIETYLLEKSRVTFQLKAERSYHIFYQITSNKKPDL
IEMLLITTNPYDYAFVSQGEITVPSIDDQEELMATDSAIDILGFTPEEKVSIYKLTGAVM
HYGNMKFKQKQREEQAEPDGTEVADKAAYLQSNSADLLKALCYPRVKVGNEYVTKGQTVQ
QVYNAVGALAKAVYEKMFLWMVTRINQQLDTKQPRQYFIGVLDIAGFEIFDFNSLEQLCI
NFTNEKLQQFFNHHMFVLEQEEYKKEGIEWTFIDFGMDLAACIELIEKPLGIFSILEEEC
MFPKATDTSFKNKLYDQHLGKSANFQKPKVVKGKAEAHFSLIHYAGTVDYNITGWLDKNK
DPLNDTVVGLYQKSAMKTLASLFSTYASAEADSSAKKGAKKKGSSFQTVSALFRENLNKL
MTNLRSTHPHFVRCIIPNETKTPGAMEHELVLHQLRCNGVLEGIRICRKGFPSRILYGDF
KQRYKVLNASAIPEGQFIDSKKASEKLLASIDIDHTQYKFGHTKVFFKAGLLGLLEEMRD
EKLAQIITRTQAVCRGFLMRVEYQKMLQRREALFCIQYNVRAFMNVKHWPWMKLFFKIKP
LLKSAETEKEMATMKEDFQKTKDELAKSEAKRKELEEKMVTLLKEKNDLQLQVQSEADSL
ADAEERCEQLIKNKIQLEAKIKEVTERAEEEEEINAELTAKKRKLEDECSELKKDIDDLE
LTLAKVEKEKHATENKVKNLTEEMAGLDEIIAKLSKEKKALQETHQQTLDDLQAEEDKVN
ILTKAKTKLEQQVDDLEGSLEQEKKLRMDLERAKRKLEGDLKLAQESTMDIENDKQQLDE
KLKKKEFEISNLISKIEDEQAVEIQLQKKIKELQARIEELEEEIEAERASRSKAEKQRSD
LSRELEEISERLEEAGGATSAQVELNKKREAEFQKLRRDLEEATLQHEAMAAALRKKHAD
SMAELAEQIDNLQRVKQKLEKEKSELKMEIDDLSSNAEVISKAKGNLEKMCRSLEDQVSE
LKTKEEEQQRLINDLTAQRAHLQTEAGEYSRLLDEKDALVSQLSRSKQASTQQIEELKYQ
LEEETKAKNALAHALQSSRHDCDLLREQYEEEQEGKAELQRALSKANSEVAQWRTKYETD
AIQRTEELEEAKKKLAQRLQEAEEHVEAVNAKCASLEKTKQRLQNEVEDLMLDVERSNAA
CAALDKKQRNFDKVLSEWKQKYEETQAELETSQKESRSLSTELFKVKNAYEESLDQLETL
RRENKNLQQEISDLTEQIAEGGKQIHELEKIKKQVEQEKCEIQAALEEAEASLEHEEGKI
LRIQLELNQVKSEVDRKIAEKDEEIDQLKRNHTRVVETMQSTLDAEIRSRNDALRVKKKM
EGDLNEMEIQLNHANRLAAESLRNYRNTQGILKETQLHLDDALQGQEDLKEQLAIVERRA
NLLQAEIEELRATLEQTERSRKIAEQELLDASERVQLLHTQNTSLINTKKKLENDVSQLQ
TEVEEVIQESRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNLEQTVKDLQHRLD
EAEQLALKGGKKQIQKLEARVRELEGEVENEQKRNAEAVKGLRKHERRVKELTYQTEEDR
KNVLRLQDLVDKLQAKVKSYKRQAEEAEEQSNANLSKFRKLQHELEEAEERADIAESQVN
KLRVKSREVHTKVSAE
Download sequence
Identical sequences H2NSR0
ENSPPYP00000008973 ENSPPYP00000008973 9600.ENSPPYP00000008973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]