SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000008974 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000008974
Domain Number 1 Region: 57-841
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.36e-291
Family Motor proteins 6.5e-18
Further Details:      
 
Domain Number 2 Region: 842-966
Classification Level Classification E-value
Superfamily Myosin rod fragments 1.96e-28
Family Myosin rod fragments 0.00000124
Further Details:      
 
Domain Number 3 Region: 1238-1355
Classification Level Classification E-value
Superfamily Myosin rod fragments 4.18e-27
Family Myosin rod fragments 0.0047
Further Details:      
 
Domain Number 4 Region: 959-1074
Classification Level Classification E-value
Superfamily Myosin rod fragments 2.25e-25
Family Myosin rod fragments 0.0012
Further Details:      
 
Domain Number 5 Region: 1433-1555
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000000000000139
Family Myosin rod fragments 0.0057
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000008974
Domain Number - Region: 1073-1186
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000107
Family Myosin rod fragments 0.0053
Further Details:      
 
Domain Number - Region: 1734-1936
Classification Level Classification E-value
Superfamily Tropomyosin 0.00015
Family Tropomyosin 0.0013
Further Details:      
 
Domain Number - Region: 1569-1663
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0392
Family Myosin rod fragments 0.011
Further Details:      
 
Domain Number - Region: 1355-1432
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0471
Family Myosin rod fragments 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000008974   Gene: ENSPPYG00000007981   Transcript: ENSPPYT00000009340
Sequence length 1939
Comment pep:known_by_projection chromosome:PPYG2:17:10595537:10620173:-1 gene:ENSPPYG00000007981 transcript:ENSPPYT00000009340 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSDSEMAVFGEAAPFLRKSERERIEAQNKPFDAKTSVFVVDAKESFVKATVQSREGGKV
TAKTEAGATVTVKEDQVFPMNPPKYDKIEDMAMMTHLHEPAVLYNLKERYAAWMIYTYSG
LFCVTVNPYKWLPVYNAEVVTAYRGKKRQEAPPHIFSISDNAYQFMLTDRENQSILITGE
SGAGKTVNTKRVIQYFATIAVTGEKKKEEVTSGKMQGTLEDQIISANPLLEAFGNAKTVR
NDNSSRFGKFIRIHFGTTGKLASADIETYLLEKSRVTFQLKAERSYHIFYQIMSNKKPDL
IEMLLITTNPYDYAFVSQGEITVPSIDDQEELMATDSAIEILGFTSDERVSIYKLTGAVM
HYGNMKFKQKQREEQAEPDGTEVADKAAYLQNLNSADLLKALCYPRVKVGNEFVTKGQTV
QQVYNAVGALAKAVYEKMFLWMVTRINQQLDTKQPRQYFIGVLDIAGFEIFDFNSLEQLC
INFTNEKLQQFFNHHMFVLEQEEYKKEGIEWTFIDFGMDLAACIELIEKPMGIFSILEEE
CMFPKATDTSFKNKLYEQHLGKSNNFQKPKPAKGKPEAHFSLIHYAGTVDYNIAGWLDKN
KDPLNETVVGLYQKSAMKTLALLFVGATGAEAEAGGGKKGGKKKGSSFQTVSALFRENLN
KLMTNLRSTHPHFVRCIIPNETKTPGAMEHELVLHQLRCNGVLEGIRICRKGFPSRILYA
DFKQRYKVLNASAIPEGQFIDSKKASEKLLASIDVDHTQYKFGHTKVFFKAGLLGLLEEM
RDEKLAQLITRTQAMCRGFLARVEYQKMVERRESIFCIQYNIRAFMNVKHWPWMKLYFKI
KPLLKSAETEKEMANMKEEFEKTKEELAKTEAKRKELEEKMVTLMQEKNDLQLQVQAEAD
SLADAEERCDQLIKTKIQLEAKIKEVTERAEDEEEINAELTAKKRKLEDECSELKKDIDD
LELTLAKVEKEKHATENKVKNLTEEMAGLDETIAKLTKEKKALQEAHQQTLDDLQAEEDK
VNTLTKAKIKLEQQVDDLEGSLEQEKKIRMDLERAKRKLEGDLKLAQESTMDIENDKQQL
DEKLKKKEFEMSGLQSKIEDEQALGMQLQKKIKELQARIEELEEEIEAERASRAKAEKQR
SDLSRELEEISERLEEAGGATSAQIEMNKKREAEFQKMRRDLEEATLQHEATAATLRKKH
ADSVAELGEQIDNLQRVKQKLEKEKSEMKMEIDDLASNMETVSKAKGNLEKMCRALEDQL
SEIKTKEEEQQRLINDLTAQRAHLQTESGEYSRQLDEKDTLVSQLSRGKQAFTQQIEELK
RQLEEEIKAKSALAHALQSSRHDCDLLREQYEEEQEAKAELQRAMSKANSEVAQWRTKYE
TDAIQRTEELEEAKKKLAQRLQDAEEHVEAVNAKCASLEKTKQRLQNEVEDLMIDVERTN
AACAALDKKQRNFDKILAEWKQKCEETHAELEASQKESRSLSTELFKIKNAYEESLDQLE
TLKRENKNLQQEISDLTEQIAEGGKRIHELEKIKKQVEQEKSELQAALEEAEASLEHEEG
KILRIQLELNQVKSEVDRKIAEKDEEIDQLKRNHIRIVESMQSTLDAEIRSRNDAIRLKK
KMEGDLNEMEIQLNHANRMAAEALRNYRNTQAILKDTQLHLDDALRSQEDLKEQLAMVER
RANLLQAEIEELRATLEQTERSRKIAEQELLDASERVQLLHTQNTSLINTKKKLETDISQ
IQGEMEDIIQEARNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNLEQTVKDLQHR
LDEAEQLALKGGKKQIQKLEARVRELEGEVESEQKRNVEAVKGLRKHERKVKELTYQTEE
DRKNILRLQDLVDKLQAKVKSYKRQAEEAEEQSNVNLSKFRKIQHELEEAEERADIAESQ
VNKLRVKSREVHTKIISEE
Download sequence
Identical sequences H2NSR1
ENSPPYP00000008974 ENSPPYP00000008974 9600.ENSPPYP00000008974 XP_002827078.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]