SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000008975 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000008975
Domain Number 1 Region: 57-843
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.87e-292
Family Motor proteins 8.26e-18
Further Details:      
 
Domain Number 2 Region: 1240-1358
Classification Level Classification E-value
Superfamily Myosin rod fragments 9.42e-29
Family Myosin rod fragments 0.0046
Further Details:      
 
Domain Number 3 Region: 844-968
Classification Level Classification E-value
Superfamily Myosin rod fragments 2.09e-28
Family Myosin rod fragments 0.00000131
Further Details:      
 
Domain Number 4 Region: 966-1076
Classification Level Classification E-value
Superfamily Myosin rod fragments 7.06e-25
Family Myosin rod fragments 0.0011
Further Details:      
 
Domain Number 5 Region: 1435-1557
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000000000000248
Family Myosin rod fragments 0.0073
Further Details:      
 
Domain Number 6 Region: 1075-1188
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000288
Family Myosin rod fragments 0.0043
Further Details:      
 
Domain Number 7 Region: 1734-1938
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000654
Family Tropomyosin 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000008975
Domain Number - Region: 1571-1665
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0105
Family Myosin rod fragments 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000008975   Gene: ENSPPYG00000007982   Transcript: ENSPPYT00000009341
Sequence length 1941
Comment pep:known_by_projection chromosome:PPYG2:17:10624699:10653164:-1 gene:ENSPPYG00000007982 transcript:ENSPPYT00000009341 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSDSELAVFGEAAPFLRKSERERIEAQNRPFDAKTSVFVVEPKESFVKGTIQSREGGKV
TVKTEGGATLTVKDDQVFPMNPPKYDKIEDMAMMTHLHEPAVLYNLKERYAAWMIYTYSG
LFCVTVNPYKWLPVYKPEVVTAYRGKKRQEAPPHIFSISDNAYQFMLTDRENQSILITGE
SGAGKTVNTKRVIQYFATIAVTGEKKKEEVTSGKIQGTLEDQIISANPLLEAFGNAKTVR
NDNSSRFGKFIRIHFGTTGKLASADIETYLLEKSRVVFQLKAERSYHIFYQITSNKKPEL
IEMLLITTNPYDYPFVSQGEISVASIDDQEELMATDSAIDILGFTNEEKVSIYKLTGAVM
HYGNLKFKQKQREEQAEPDGTEVADKAAYLQSLNSADLLKALCYPRVKVGNEYVTKGQTV
EQVTNAVGALAKAVYEKMFLWMVARINQQLDTKQPRQYFIGVLDIAGFEIFDFNSFEQLC
INFTNEKLQQFFNHHMFVLEQEEYKKEGIEWTFIDFGMDLAACIELIEKPMGIFSILEEE
CMFPKATDTSFKNKLYDQHLGKSANFQKPKVVKGKAEAHFSLIHYAGVVDYNIGGWLEKN
KDPLNETVVGLYQKSAMKTLAHLFSGAQTAEGEGAGGGAKKGGKKKGSSFQTVSALFREN
LNKLMTNLRSTHPHFVRCIIPNETKTPGAMEHELVLHQLRCNGVLEGIRICRKGFPSRIL
YADFKQRYKVLNASAIPEGQFIDSKKASEKLLASIDIDHTQYKFGHTKVFFKAGLLGLLE
EMRDDKLAQLITRTQARCRGFLARVEYQRMVERREAVFCIQYNIRSFMNVKHWPWMKLFF
KIKPLLKSAETEKEMATMKEEFQKIKDELAKSEAKRKELEEKMVTLLKEKNDLQLQVQAE
AEGLADAEERCDQLIKTKIQLEAKIKEVTERAEDEEEINAELTAKKRKLEDECSELKKDI
DDLELTLAKVEKEKHATENKVKNLTEEMAGLDETIAKLTKEKKALQEAHQQTLDDLQAEE
DKVNTLTKAKIKLEQQVDDLEGSLEQEKKLRMDLERAKRKLEGDLKLAQESIMDIENEKQ
QLDEKLKKKEFEISNLQSKIEDEQALGIQLQKKIKELQARIEELEEEIEAERASRAKAEK
QRSDLSRELEEISERLEEAGGATSAQIEMNKKREAEFQKMRRDLEEATLQHEATAATLRK
KHADSVAELGEQIDNLQRVKQKLEKEKSEMKMEIDDLASNVETVSKAKGNLEKMCRTLED
QLSELKSKEEEQQRLINDLTAQRGRLQTESGEFSRQLDEKEALVSQLSRGKQAFTQQIEE
LKRQLEEEIKAKNALAHALQSSRHDCDLLREQYEEEQESKAELQRALSKANTEVAQWRTK
YETDAIQRTEELEEAKKKLAQRLQAAEEHVEAVNAKCASLEKTKQRLQNEVEDLMLDVER
TNAACAALDKKQRNFDKILAEWKQKCEETHAELEASQKEARSLGTELFKIKNAYEESLDQ
LETLKRENKNLQQEISDLTEQIAEGGKRIHELEKIKKQVEQEKCELQAALEEAEASLEHE
EGKILRIQLELNQVKSEVDRKIAEKDEEIDQLKRNHIRIVESMQSTLDAEIRSRNDAIRL
KKKMEGDLNEMEIQLNHANRMAAEALRNYRNTQGILKDTQIHLDDALRSQEDLKEQLAMV
ERRANLLQAEIEELRATLEQTERSRKIAEQELLDASERVQLLHTQNTSLINTKKKLETDI
SQMQGEMEDILQEARNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTVKDLQ
LRLDEAEQLALKGGKKQIQKLEARVRELEGEVESEQKRNAEAVKGLRKHERRVKELTYQT
EEDRKNILRLQDLVDKLQAKVKSYKRQAEEAEEQSNTNLAKFRKLQHELEEAEERADIAE
SQVNKLRVKSREVHTKVISEE
Download sequence
Identical sequences H2NSR2
ENSPPYP00000008975 ENSPPYP00000008975 9600.ENSPPYP00000008975 XP_002827079.2.23681 XP_003778788.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]