SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000008982 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPPYP00000008982
Domain Number - Region: 33-120
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00314
Family LacY-like proton/sugar symporter 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000008982   Gene: ENSPPYG00000007989   Transcript: ENSPPYT00000009348
Sequence length 135
Comment pep:known_by_projection chromosome:PPYG2:17:10966758:10967165:-1 gene:ENSPPYG00000007989 transcript:ENSPPYT00000009348 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METLPKVLEVDEKSPEANDLLPSQTASSLCISSRSESVWTTTPRSNWEIYRKPIVIMSVG
GAILLFSVVITCLAYILKLSKKSFSILKMVGPGFLSLGLMMLVCGLVWVPIIKKKQRHRK
KSNFLRSLKSFFLTR
Download sequence
Identical sequences H2NSR9
9600.ENSPPYP00000008982 ENSPPYP00000008982 ENSPPYP00000008982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]