SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000008985 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000008985
Domain Number 1 Region: 36-123
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 4.35e-36
Family SCAN domain 0.0000526
Further Details:      
 
Domain Number 2 Region: 444-501
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.13e-22
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 3 Region: 486-538
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.67e-21
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 4 Region: 408-458
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000154
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 5 Region: 222-262
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000034
Family KRAB domain (Kruppel-associated box) 0.0038
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000008985
Domain Number - Region: 331-352
Classification Level Classification E-value
Superfamily TTHA1013/TTHA0281-like 0.017
Family TTHA0281-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000008985   Gene: ENSPPYG00000007992   Transcript: ENSPPYT00000009351
Sequence length 549
Comment pep:known_by_projection chromosome:PPYG2:17:12184091:12200032:-1 gene:ENSPPYG00000007992 transcript:ENSPPYT00000009351 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVDLGQALGLLPSLAKAEDSQFSESDAALQEELSSPETARQLFRQFRYQVMSGPHETLK
QLRKLCFQWLQPEVHTKEQILEILMLEQFLTILPGEIQMWVRKQCPGSGEEAVTLVESLK
GDPQRLWQWISIQVLGQDLLAEKMESPSCQVGEVEPHLEVVPQELGLENSSSGPGELLGH
IVKEESDTEAGLALAASQPARLEERLIRDQDLGASLLPAAPQEQWRHLDSTQKEQYWDLM
LETYGKMVSGAGISHPKSDLTNSIEFGDEPAGLYLHVNEKIPRPTCIGDRQENDKENLNL
ENHRDQELLHASCQASGEVPSQASLRGFFSEDEPGCFGEGENLPEALQNIQDEGTGEQLS
PQERISEKQLGQHLPNPHSGEMSTMWLEEKRETSQKGQPRAPMAQKLPTCRECGKTFYRN
SQLVFHQRTHTGETYFQCTICKKAFLRSSDFVKHQRTHTGEKPCKCDYCGKGFSDFSGLR
HHEKIHTGEKPYKCPICEKSFIQRSNFNRHQRVHTGEKPYKCSHCGKSFSWSSSLDKHQR
SHLGKKPFQ
Download sequence
Identical sequences H2NSS2
ENSPPYP00000008985 9600.ENSPPYP00000008985 XP_002827097.1.23681 ENSPPYP00000008985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]