SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000009038 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000009038
Domain Number 1 Region: 350-421
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 5.37e-19
Family HLH, helix-loop-helix DNA-binding domain 0.0000143
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000009038   Gene: ENSPPYG00000008037   Transcript: ENSPPYT00000009404
Sequence length 1153
Comment pep:known_by_projection chromosome:PPYG2:17:18160678:18186163:-1 gene:ENSPPYG00000008037 transcript:ENSPPYT00000009404 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEPPFSEAALEQALGEPCDLDLALLTDIEGEVGAGRGRANRLDAPRAGADRGAMDCTFE
DMLQLINNQDSDFPGLFDPPYAGSGAGGTDPASPDTSSPGSLSPPPATLSSSLEAFLSGP
KAAPSPLSPPQPAPTPLKMYPSMPAFSPGPGIKEESVPLSILQTPTPQPLPGALLPQSFP
APAPPQFSSTPVLGYPSPPGGFSTGSPPGSTQQPLPGLPLASPPGVPPVSLHTQAQSVVP
QQLLTVTAAPTAAPVTTTVTSQIQQVPVLLQPHFIKADSLLLTAVKTDGATVKAAGLSPL
VSGTTVQTGPLPTLVSGGTILATVPLVVDADKLPINRLAAGSKASGSAQSRGEKRTAHNA
IEKRYRSSINDKIIELKDLVVGTEAKLNKSAVLRKAIDYIRFLQHSNQKLKQENLSLRTA
VHKSKSLKDLVSACGSGGNTDVLMEGVKTEVEDTLTPPPSDAGSPFQSSPLSLGSRGSGS
GGSGSDSEPDSPAFEDSKAKPEQRPSSHSRGMLDRSRLALCTLVFLCLSCNPLASLLGAR
GLPSPSDTTSVYHSPGRNVLGTESRDGPGWAQWLLPPVVWLLNGLLVLVSLVLLFVYGEP
VTRPHSGPAVYFWRHRKQADLDLARGDFAQAAQQLWLALRALGRPLPTSHLDLACSLLWN
LIRHLLQRLWVGRWLAGRAGGLQQDCALRVDACASARDAALVYHKLHQLHTMGKYTGGHL
TATNLALSALNLAECAGDAVSVATLAEIYVAAALRVKTSLPRALHFLTRFFLSSARQACL
AQSGSVPPAMQWLCHPVGHRFFVDGDWAVLSTPRESLYSLAGNPVDPLAQVTQLFREHLL
ERALNCVTQPSPSPGSADGDKEFSDALGYLQLLNSCSDAAGAPACSFSISSSMATTTGVD
PVAKWWASLTAVVIHWLRRDEEAAERLCPLVEHLPRVLQESERPLPRAALHSFKAAWALL
GCAKAESGPASLTAVQLFLCDLLLVVRTSLWRQQQPPAPAPAAQGTSSRPHASALELRGF
QRDLSSLRRLAQSFRPAMRRVFLHEATARLMAGASPTRTHQLLDRSLRRRAGPGGKGGAV
AELEPRPTRREHAEALLLASCYLPPGFLSAPGQRVGMLAEAARTLEKLGDRRLLHDCQQM
LMRLGGGTTVTSS
Download sequence
Identical sequences H2NSX1
9600.ENSPPYP00000009038 ENSPPYP00000009038 ENSPPYP00000009038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]