SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000009101 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000009101
Domain Number 1 Region: 74-445
Classification Level Classification E-value
Superfamily MFS general substrate transporter 2.62e-30
Family LacY-like proton/sugar symporter 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000009101   Gene: ENSPPYG00000008094   Transcript: ENSPPYT00000009471
Sequence length 459
Comment pep:known_by_projection chromosome:PPYG2:17:23044453:23051705:-1 gene:ENSPPYG00000008094 transcript:ENSPPYT00000009471 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGSASPPEKHRARPAAAVLCRGPVEPLVFLANFALVLQGPLTTQYLWHRFSADLGYNGT
RQRGGCSNRSADPTMQEVETLTSHWTLYMNVGGFLVGLLSSTLLGTWSDGVGRRPLLVLA
SLGLLLQALVSVFVVQLQLHVGYLVLGRILCALLGDFGGLLAASFASVADVSSSRSRTFR
MALLEASIGVAGMLASLLGGHWLRAQGYANPFWLALALLIAMTLYAAFCFGETLKEPKST
RLFTFRHHRSIVQLYVAPAPEKSRKHLALYSLAIFVVITVHFGAQDILTLYELSTPLCWD
SKLIGYGSAAQHLPYLTSLLALKLLQYCLADAWVAEIGLAFNILGMVVFAFATITPLMFT
GYGLLFLSLVITPVIRAKLSKLVRETEQGALFSAVACVNSLAMLTASGIFNSLYPATLNF
MKGFPFLLGAGLLLIPAILIGMLEKADPHPEFQQFPQSP
Download sequence
Identical sequences H2NT33
9600.ENSPPYP00000009101 ENSPPYP00000009101 ENSPPYP00000009101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]