SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000009110 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000009110
Domain Number 1 Region: 91-270
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.72e-48
Family Protein kinases, catalytic subunit 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000009110   Gene: ENSPPYG00000008102   Transcript: ENSPPYT00000009480
Sequence length 274
Comment pep:novel chromosome:PPYG2:17:23345091:23347855:-1 gene:ENSPPYG00000008102 transcript:ENSPPYT00000009480 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAVSCRQGQHTQQGEHARVAVPHKQGGNIRGPWARGWKSLWSGVGTIRSDLEELWELRG
HRYLHRESLKPAPLLVEKPLPEWPVPQFINLFLPEFPIRPIRGQQQLKILGLVAKGSFGT
VLKVLDCTQNAVFAVKVVPKVKVLQRDTVRQCKEEVSIQRQINHPFVHSLGDSWQGKRHL
FIMCSYCSTDLYSLWLAVGCFPEASIRLFAAELVLVLCYLHDLGIMHRDVKMENILLDER
GHLKLTDFGLSRHVPQGARAYTICGTLQYMGERG
Download sequence
Identical sequences H2NT42
ENSPPYP00000009110 ENSPPYP00000009110 9600.ENSPPYP00000009110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]