SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000009129 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000009129
Domain Number 1 Region: 371-969,1012-1051,1081-1239
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.01e-194
Family Motor proteins 0.0000000277
Further Details:      
 
Domain Number 2 Region: 207-307
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000000736
Family PDZ domain 0.0078
Further Details:      
 
Domain Number 3 Region: 1441-1556
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000154
Family Myosin rod fragments 0.0075
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000009129
Domain Number - Region: 1713-1808
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000127
Family Myosin rod fragments 0.0073
Further Details:      
 
Domain Number - Region: 1243-1339
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00785
Family Myosin rod fragments 0.013
Further Details:      
 
Domain Number - Region: 1528-1639
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0107
Family Myosin rod fragments 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000009129   Gene: ENSPPYG00000008119   Transcript: ENSPPYT00000009499
Sequence length 2034
Comment pep:known_by_projection chromosome:PPYG2:17:23822327:23917734:-1 gene:ENSPPYG00000008119 transcript:ENSPPYT00000009499 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFNLMKKDKDKDGGRKEKKEKKEKKERMSAAELRSLEEMSLRRGFFNLNRSSKRESKTRL
EISNPIPIKVASGSDLHLTDDSDSNRGSVILSGHLSTASSSDDLKGEEGSFRGSVLQRAA
KFGSLKQNSQMIVKRFFSQRSRDESASETSTPSEHSAAPSPQVEVRTLEGQLVQHPGPGI
PRPGHRSRAPELVTKKFPVDLRLPPVVPLPPPALRELELQRRPTGDFGFSLRRTTMLDRG
PEGQVYRRVVHFAEPGAGTKDLALGLVPGDRLVEINGHNVESKSRDEIVEMIRQSGDSVR
LKVQPIPELSELSRSWLRSGEGPRREPSDAKTEEQIAAEEAWNETEKVWLVHRDGFSLAS
QLKSEELNLPEGKVRVKLDHDGAILDVDEDDVEANAPSCDRLEDLASLVYLNESSVLHTL
RQRYGASLLHTYAGPSLLVLGPRGAPAVYSEKVMHMFKGCRREDMAPHIYAVAQTAYRAM
LMSRQDQSIILLGSSGSGKTTSCQHLVQYLATIAGISGNKVFSAEKWQALYTLLEAFGNS
PTIMNGNATRFSQILSLDFDQAGQVASASIQTMLLEKLRVARRPASEATFNVFYYLLACG
DGTLRTELHLNHLAENSVFGIVPLAKPEEKQKAAQQFSKLQAAMKVLGISPDEQKACWLI
LAAIYHLGAAGATKVHSTAGRKQFARHEWAQKAAYLLGCSLEELSSAIFKHQHKGGTLQR
STSFRQGPEESCLGDGTGPKLSALECLEGMAAGLYSELFTLLVSLVNRALKSSQHSLCSM
MIVDTPGFQNPEQGGSARGASFEELCHNYTQDRLQRLFHERTFVQELERYKEENIELAFD
DLEPPTDDSVAAVDQASHQSLVRSLARTDEARGLLWLLEEEALVPGASEDALLERLFSYY
GPQEGDRKGQSPLLHSSKPHHFLLGHSHGTNWVEYNVTGWLNYTKQNPATQNAPRLLQDS
QKKIISNLFLGRAGSATVLSGSIAGLEGGSQLALRRATSMRKTFTTGMAAVKKKSLCIQM
KLQVDALIDTIKKSKLHFVHCFLPVAEGWAGEPRSASSRRVSSSSELDLPSGDHCEAGLL
QLDVPLLRTQLRGSRLLDAMRMYRQGYPDHMVFSEFRRRFDVLAPHLTKKHGRNYIVVDE
RRAVEELLECLDLEKSSCCMGLSRVFFRAGTLARLEEQRDEQTSRNLTLFQAACRGYLAR
QHFKKRKIQDLAIRCVQKNIKKNKGVKDWLWWKLFTTVRPLIEVQLSEEQIRNKDEEIQQ
LRSKLEKVEKERNELRLNSDRLESRISELTSELTDERNTGESASQLLDAETAERLRAEKE
MKELQTQYDALKKQMEVMEMEVMEARLIRAAEINGEVDDDDAGGEWRLKYERAVREVDFT
KKRLQQEFEDKLEVEQQNKRQLERRLGDLQADSEESQRALQQLKKKCQRLTAELQDTKLH
LEGQQVRNHELEKKQRRFDSELSQAHEEAQREKLQREKLQREKDMLLAEAFSLKQQLEEK
DMDIAGFTQKVVSLEAELQDISSQESKDEASLAKVKKQLRDLEAKVKDQEEELDEQAGTI
QMLEQAKLRLEMEMERMRQTHSKEMESRDEEVEEARQSCQKKLKQMEVQLEEEYEDKQKV
LREKRELEGKLATLSDQVNRRDFESEKRLRKDLKRTKALLADAQLMLDHLKNSAPSKREI
AQLKNQLEESEFTCAAAVKARKAMEVEIEDLHLQIDDIAKAKTALEEQLSRLQREKNEIQ
NRLEEDQEDMNELMKKHKAAVAQASRDLAQINDLQAQLEEANKEKQELQEKLQALQSQVE
FLEQSMVDKSLVSRQEAKIRELETRLEFERTQVKRLESLASRLKENMEKLTEERDQRIAA
ENREKEQNKRLQRQLRDTKEEMGELARKEAEASRKKHELEMDLESLEAANQSLQADLKLA
FKRIGDLQAAIEDEMESDENEDLINSEGDSDVDSELEDRVDGVKSWLSKNKGPSKAASDD
GSLKSSSPTNYWKSLAPDRSDDEHDPLNNTSRPRYSHSYLSDSDTEAKLTETNA
Download sequence
Identical sequences H2NT61
ENSPPYP00000009129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]