SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000009144 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000009144
Domain Number 1 Region: 362-658
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.65e-84
Family Pancreatic carboxypeptidases 0.00000000163
Further Details:      
 
Domain Number 2 Region: 792-1076
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 3.31e-67
Family Pancreatic carboxypeptidases 0.0000137
Further Details:      
 
Domain Number 3 Region: 1-245
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 5.29e-61
Family Pancreatic carboxypeptidases 0.00000138
Further Details:      
 
Domain Number 4 Region: 658-738
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 7.65e-19
Family Carboxypeptidase regulatory domain 0.0000316
Further Details:      
 
Domain Number 5 Region: 246-331
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 1.26e-16
Family Carboxypeptidase regulatory domain 0.001
Further Details:      
 
Domain Number 6 Region: 1077-1175
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0000000000122
Family Carboxypeptidase regulatory domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000009144   Gene: ENSPPYG00000008134   Transcript: ENSPPYT00000009514
Sequence length 1243
Comment pep:known_by_projection chromosome:PPYG2:17:25152524:25246785:1 gene:ENSPPYG00000008134 transcript:ENSPPYT00000009514 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHGDETVSRQVLIYLARELAAGYRRGDPRLVRLLNTTDVYLLPSLNPDGFERAREGDCGF
GDGGPPGASGRDNSRGRDLNRSFPDQFSTGEPPALDEVPEVRALIEWIRRNKFVLSGNLH
GGSVVASYPFDDSPEHKAAGIYSKTSDDEVFKYLAKAYASNHPIMKTGEPHCPGDEDETF
KDGITNGAHWYDVEGGMQDYNYVWANCFEITLELSCCKYPPASQLRQEWENNRESLITLI
EKVHIGVKGFVKDSITGSGLENATISVAGINHNITTGRFGDFYRLLVPGTYNLTVVLTGY
LPLAVTNVVVKEGPATEVDFSLRPTVTSVIPDTTEAVATASTVAIPNILSGTSSSYQPMQ
PKDFHHHHFPDMEIFLRRFANEYPNITRLYSLGKSVESRELYVMEISDNPGVHEPGEPEF
KYIGNMHGNEVVGRELLLNLIEYLCKNFGTDPEVTDLVHSTRIHLMPSMNPDGYEKSQEG
DSISVIGRNNSNNFDLNRNFPDQFVQITDPTQPETIAVMSWMKSYPFVLSANLHGGSLVV
NYPFDDDEQGLATYSKSPDDAVFQQIALSYSKENSQMFQGRPCKNMYPNEYFPHGITNGA
SWYNVPGGMQDWNYLQTNCFEVTIELGCVKYPFEKELPNFWEQNRRSLIQFMKQVHQGVK
GFVLDATDGRGILNATISVAEINHPVTTYKTGDYWRLLVPGSYKITASARGYNPVTKNVT
VKSEGAIQVNFTLVRSSTDSNNESKKGKGASTSTSDASDPTTKEFETLIKDLSAENGLES
LVLRSSSNLALALYRYHSYKDLSEFLRGLVMNYPHITNLTNLGQSTEYRHIWSLEISNKP
NVSEPEEPKIRFVAGIHGNAPVGTELLLALAEFLCLNYKKNPAVTQLVDRTRIVIVPSLN
PDGRERAQEKDCTSKIGQTNALGKDLDTDFTNNASQPETKAIIENLIQKQDFSLSVALDG
GSVLVTYPYDKPVQTVENKETLKHLASLYANNHPSMHMGQPSCPNKSDENIPGGVMRGAE
WHSHLGSMKDYSVTYGHCPEITVYTSCCYFPSAAQLPSLWADNKRSLLSMLVEVHKGVHG
FVKDKTGKPISKAVIVLNEGIKVHPKEGGYFHVLLAPGVHNINAIADGYQQQHSQVFVHH
DAASSVVIVFDTDNRIFGLPRELVVTVSGATMSALILTACIIWCICSIKSNRHKDGFHRL
RQHHDEYEDEIRMMSTGSKKSLLSHEFQDETDTEEETLYSSKH
Download sequence
Identical sequences H2NT76
ENSPPYP00000009144 ENSPPYP00000009144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]