SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000009154 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000009154
Domain Number 1 Region: 57-120
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.0000000002
Family ComEA-like 0.052
Further Details:      
 
Domain Number 2 Region: 170-354
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.00000205
Family Mitochondrial resolvase ydc2 catalytic domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000009154   Gene: ENSPPYG00000008143   Transcript: ENSPPYT00000009524
Sequence length 360
Comment pep:novel chromosome:PPYG2:17:25698360:25708035:-1 gene:ENSPPYG00000008143 transcript:ENSPPYT00000009524 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGSVLFTAGERWRCFLTPSRSSLFWALHNFCCRKKSTTPKKITPNVTFCDENAKESENA
LDKLFSSEQQASILHVLNTASTKELEAFRLLRGRRSINIVEHRENFGPFQNLESLMNVPL
LKYKSTVQVCNSILCPKTGREKRKSPENRFLRKLLKPDIERERLKAVNSIISIVFGTRRI
AWAHLDRKLTVLDWQQSDRWSLMRGIYSSSVYLEEISSIISKMPKADFYVLEKTGLSIQN
SSLFPILLHFHIMEAMLYALLNKTFAQDGQHQVLSMNRNAVGKHFKLMIGDSRSSGKELV
KQFLSDSILKADPRVFFPSDKIVHYRHMFLSTELQRVEELYDSLLQAIAFYELAVFDSEP
Download sequence
Identical sequences H2NT85
ENSPPYP00000009154 9600.ENSPPYP00000009154 XP_002827270.1.23681 ENSPPYP00000009154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]