SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000009190 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000009190
Domain Number 1 Region: 49-84
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000714
Family HkH motif-containing C2H2 finger 0.044
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000009190
Domain Number - Region: 267-335
Classification Level Classification E-value
Superfamily occludin/ELL-like 0.0209
Family Occludin/ELL domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000009190   Gene: ENSPPYG00000008175   Transcript: ENSPPYT00000009561
Sequence length 372
Comment pep:known_by_projection chromosome:PPYG2:17:29695370:29696488:1 gene:ENSPPYG00000008175 transcript:ENSPPYT00000009561 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSASARTPAGKRVVNQEELRRLMKEKQRLSTNRKRIESPFAKYNRLGQLSCALCNTPV
KSELLWQTHVLGKQHREKVADLKGAKEASQGSSASSAPQSVKRKAPDADDQDVKRAKATL
VPQVQPSTSALPTNFDKIGKEFIRATPSKPSGLSLLPDYEDEEEEEEEEEGDGERKRGDA
SKPLSDAQGKEHSVSSSREVTSSVLPDDFFSTNPPKAPIIPHSGSIEKAEIHEKVVERRE
NTAEALPEGFFDDPEVDARVRKVDAPKDQMDKEWDEFQKAMRQVNTISEAIVAEEDEEGR
LDRQIGEIDEQIECYRRVEKLRNRQDEIKNKLKEILTIKELQKKEEENADSDDEGELQDL
LSQDWRVKGALL
Download sequence
Identical sequences H2NTC1
ENSPPYP00000009190 9600.ENSPPYP00000009190 XP_002827300.2.23681 ENSPPYP00000009190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]